KEGG   Meleagris gallopavo (turkey): 100544478Help
Entry
100544478         CDS       T01523                                 

Definition
(RefSeq) trypsin II-P29
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04080  Neuroactive ligand-receptor interaction
mgp05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100544478
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    100544478
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100544478
Peptidases [BR:mgp01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100544478
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100544478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 100544478
NCBI-ProteinID: XP_019473799
Ensembl: ENSMGAG00000014219
UniProt: G1NN41
LinkDB All DBs
Position
1
AA seq 248 aa AA seqDB search
MNSLFLILSCLGAAVAFPGGADDDKIVGGYTCPEHSVPYQVSLNSGYHFCGGSLINSQWV
LSAAHCYKSRIQVRLGEYNIDVEEDSEVVRSSSVIVRHPKYSSLTLNNDIMLIKLASAVE
YSADVQPIALPSACAKAGTECLISGWGNTLSNGYNYPELLQCLKAPILSDQECQEAYPGD
ITSNMICVGFLEGGKDSCQGDSGGPVACNGELQGIVSWGIGCALKGYPGVYTKVCNYVDW
IQETIAAY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaattctctcttcctgattctctcctgcctgggagcagctgttgctttccctggaggt
gctgatgatgacaagattgtgggaggctacacctgtccagagcactcagttccctaccag
gtgtccctgaactctggctatcacttctgtggaggttccctcatcaacagccagtgggtc
ttgtcagctgctcactgctataaatcccgcatacaagtgaggctgggagagtacaacatc
gatgtggaggaagacagtgaagtagtcaggagttcatcagtaatcgttcgccatcctaaa
tacagttcactaaccctcaataatgacattatgttgatcaagttggcatctgcggtggaa
tacagtgctgacgttcaacccatagctctgcccagcgcctgtgccaaggcggggaccgag
tgcctgatttcaggatggggaaacacgctgagcaatggctacaattaccctgaacttctc
cagtgcctgaaagctccaattctgagtgaccaagagtgccaagaggcttaccctggtgat
atcaccagcaacatgatctgcgtcggattcctggagggtgggaaagactcatgccagggt
gactcaggcggaccagttgcgtgcaatggagagctgcaaggaattgtgtcctggggaatt
ggatgtgctctgaaaggttatcctggagtttacaccaaggtctgcaattacgttgactgg
atccaggaaaccattgcagcctactga

DBGET integrated database retrieval system