KEGG   Meleagris gallopavo (turkey): 100546340Help
Entry
100546340         CDS       T01523                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00020  Citrate cycle (TCA cycle)
mgp00190  Oxidative phosphorylation
mgp01100  Metabolic pathways
mgp01200  Carbon metabolism
Module
mgp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mgp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mgp_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100546340 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100546340 (SDHA)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100546340 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 100546340
NCBI-ProteinID: XP_010706908
Ensembl: ENSMGAG00000006943
LinkDB All DBs
Position
3
AA seq 657 aa AA seqDB search
KDLFHNSCLDFFLQWPAACQTFARNFHFTVDGKRSASAKVSDSISTQYPVVDHEFDAVVV
GAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEDDNWRWHFYDTV
KGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSRTEEGKIYQRAFGGQSLQFGKGGQAH
RCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGTIHRF
RAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGAGCLI
TEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGPEKDHVYLQ
LHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVITHVNG
EDKVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALTIAETCKPGEPVPSIKPN
AGEESVANLDKLRFADGTIRTSEVRLNMQKTMQSHAAVFRTGSILQEGCEILSQIYRDLA
HLKTFDRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKLRIDEFDYS
KPLQGQQKRPFEEHWRKHTLSYVDVKSGKVTLKYRPVIDRTLNEEDCSTVPPAIRSY
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
aaagatttgtttcataatagttgtcttgatttcttcctacagtggccagcggcatgccag
acttttgcacgcaactttcactttacagtcgatggaaagagaagtgcttctgccaaagtt
tctgattcgatttctacacagtatccagttgtggaccatgagtttgatgcagttgttgtg
ggtgcaggaggagcaggcctgcgggctgcatttggtttgtctgaagctggttttaataca
gcgtgtgttacaaagctgtttcccacgaggtctcatactgttgctgcgcagggagggatc
aatgcagctttggggaacatggaggatgacaactggaggtggcatttctatgatacagtg
aaaggatctgactggctgggtgaccaggatgccatacactacatgactgagcaagcccca
gctgcagtgatagagctggaaaactatgggatgccattcagtagaacagaagaaggaaaa
atctatcagcgtgcatttggtggacagagtcttcagtttggaaaaggaggacaggctcac
agatgctgttgtgttgcagacaggacaggacactcactcttgcatactctgtatggcagg
tctctaagatatgataccagctactttgttgaatattttgccttggacctgctgatggaa
aatggagaatgtcggggtgttattgctctttgcatagaagatggcactatacatcgtttt
agagcaaagaacactgtcattgccactggggggtatggccgtacttacttcagctgtaca
tctgctcatactagtacaggtgatggcactgctatggttacacgagctggccttccttgc
caggacttggagtttgtacagttccaccctacaggtatctatggggctggttgcctcata
actgaaggatgtcgtggagagggaggtattctaattaacagtcaaggtgaaaggtttatg
gagagatatgcacctgttgctaaagatctggcttccagggatgttgtgtctcgctctatg
accatagagatacgagaaggaaggggttgtggccctgaaaaagatcatgtgtatttgcag
ttgcaccatttaccaccccagcagctggcaactcgtctcccagggatttcagaaacagct
atgatatttgcaggagttgatgtcactaaagagcctattcccgttctgcctactgtgcat
tataatatgggaggtattcctactaattacaagggacaggtgatcactcatgtgaatgga
gaggataaggtggtacctggcttatacgcttgtggggaagcagcatctgcatctgtccat
ggtgctaatcgacttggagcaaactcccttttggatctggtggtctttggtcgtgcttgt
gcccttactattgcagagacctgcaagcctggagaaccagttccctccattaaaccaaat
gctggtgaagaatcagttgctaatcttgacaaattaagatttgctgatggaaccataaga
acttcagaagtgcgacttaacatgcagaagacaatgcaaagccatgccgctgtatttcgt
actggctctatactacaagaaggctgtgaaatacttagccaaatttatcgtgatctggct
catctaaagacatttgacagaggtattgtgtggaacactgatttggtggagaccctcgaa
ctgcaaaacctgatgctttgtgccctgcagaccatttatggtgctgaggctcgcaaagag
tcccgaggtgctcatgccagagaggactataagctacggatagatgagtttgactattct
aagccactccaaggccaacagaagaggccatttgaagagcattggaggaagcacaccctt
tcatatgtggatgtcaagtcggggaaggttaccttgaaatacagacctgtaattgacaga
actttgaatgaagaagactgttcaactgttccgcctgctattcgctcctattag

DBGET integrated database retrieval system