KEGG   Meleagris gallopavo (turkey): 100547277
Entry
100547277         CDS       T01523                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X2
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100547277 (CACNA1E)
   04020 Calcium signaling pathway
    100547277 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mgp04040]
    100547277 (CACNA1E)
Ion channels [BR:mgp04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100547277 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 100547277
NCBI-ProteinID: XP_010714223
Ensembl: ENSMGAG00000002963
LinkDB
Position
10
AA seq 2218 aa
MGRPGGLAAPFHFSLTSPTPFEYMILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPY
FIGIFCFEAGIKIVALGFVFHKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLR
AVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRA
CYTNNSGELEELDPPHPCGVQGCPPGYECREWIGPNDGITQFDNILFAVLTVFQCITMEG
WTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKL
RRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRNRTDAMNRDSSDE
HCVDISSVGERRLAQRRPLHPTLGNPLSRSGLKGVDGASYLRHKERLLRISVRHMVKSQV
FYWIVLSLVALNTACVAIVHHNQPAWLTHFLYYAEFLFLGLFLLEMSLKMYGMGPRLYFH
SSFNCFDCGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLM
SSMKSIISLLFLLFLFIVVFALLGMQLFGGGFNFIDGTPSANFDTFPAAIMTVFQILTGE
DWNEVMYNGIRSQGGVRSGMWSSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQ
EEEEAFNQKHALQKAKEVSPMSAPNMPAIERDRRRRHHMSMWEPRSSHLRERRRRHHMSV
WEQRTSQLRRHMQMSSQEGINKDEPPLINPHASIFRRKKPGDGVALEKCDEEQGGKGERP
PAEGPEQPAPGTNPGGGEDRRSPSPRARRDKEMWQHKACHGNCEPGEEGAGGGIEERARM
RQSQRRSRHRKARMEGKELTGALESRAGSQEMGLEEPCPAEGMQDGERRGDAAAALDLIQ
GEPEASRDPTRTNGAPTEEGSLPASAPEPARGMEGSLGEQDCSSPDTSEQALLGGAALGA
SRTVSHSEPDLSSVTANTEKATESTTIMIDVQDSTVVQISNKTDGEASPLKEAESKEDEE
EMEKKKRKKEKSETGKAMVPHSSMFIFSTTNPVRRACHYIVNLRYFEMCILLVIAASSIA
LAAEDPVLTNSDRNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFIV
VVGALVAFALATNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNIL
IVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKDCIGNYVDHEKNKMEVKCREWKRHEF
HYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFF
FVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWH
FVVSPSFEYTIMAMIALNTVVLMMKYYSAPYTYELALKYLNIAFTMVFSLECVLKIIAFG
FLNYFRDTWNIFDFITVIGSITEIILTDTKLVNTSSFNMSFLKLFRAARLIKLLRQGYTI
RILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFLGSL
MLLFRSATGEAWQEIMLSCLEGKGCEPDTTATSGQNENERCGTDLAYVYFVSFIFFCSFL
MLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRIWAEYDRAACGRISYKDMYKLVRVISP
PLGLGENCPYRVACKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADWQQLDS
ELQKEILTIWPHLSQKMLDLLVPMPKTSDLTVGKIYAAMMIMDYYKQSKAKKQRQQLEEQ
KNAPMFQRMEPSSLPQEIISNAKALPYLQQDTLTGLSSRSGFPSLSPLSPQEIFQLACMD
PAQGQFQEHQSLEPEVREFQRVQPSNRGSYLPVDTQDHAVSGRASSMPRLTVDPQVVTDT
SSMRRSFSTIRDKRTNTSWLDEFSMERSSDNTYKSRRRSYHSSLQLSARRLNADSGHRSE
GHRSGGRERGRSKERKHLLSPDISRCNSEERSPQAHDESPERRRESRSPSEGRSQTPNRQ
GTGSLSESSIPSISDTSTPRRGRRQLPPVPPKPRPLLSYASMLRHAAGDASPPPDETEGG
SPLLSKEPNAAGLTESSSSPAGKPSRPSTPQRYISEPYLALHDDSHASDCGEEETLTFEA
AVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGAGQGVMCGASIDVLSDTEEDDKC
NT seq 6657 nt   +upstreamnt  +downstreamnt
atggggaggcccggggggctggcggctccattccacttctccttgacttctcccactccc
tttgagtatatgatcctggcaaccatcattgccaactgcatcgtgctggccctggagcag
cacctcccagaggacgacaagacacccatgtcacggagactggagaagacagagccgtac
ttcattgggattttctgctttgaggctgggattaagatcgtggctctgggctttgttttc
cacaagggctcatacctgcgcaatggctggaacgtcatggacttcattgtggtcctcagt
ggcatccttgccaccgctggaacgcacttcaacacgcacgtggacctgcgcaccctgcgg
gctgtgcgtgtgctcaggcctctgaagctcgtctcgggcattcccagccttcagattgtg
ctgaaatccatcatgaaggccatggtgcctctcctccagatcggcttgctgctctttttt
gctattctcatgtttgccatcattggcctggagttttacagtgggaaactgcaccgagcc
tgctacacaaacaattcaggtgagctggaggagctggaccctccccacccctgcggggtg
cagggttgtccgccgggctatgagtgccgggagtggatcggtcccaatgatgggatcacg
cagtttgacaacatcctcttcgctgtgctgaccgtcttccagtgcatcaccatggaaggg
tggaccacagttctgtacaataccaatgatgccttaggagccacctggaactggctatac
ttcatccccctcatcatcattggatccttctttgtcctcaaccttgtcctgggagtgctg
tcaggggagtttgccaaagaacgtgagcgtgtggagaaccgccgggccttcatgaagctg
cggcgacagcagcagatcgagcgggagctcaacggctaccgggcctggatagacaaagcg
gaggaagtcatgctggctgaagagaacaaaaacgctgggacctcagccttagaagtgctc
aggcgagccaccatcaagaggaaccggacagatgccatgaaccgtgactccagcgatgag
cactgcgtcgatatctcctccgtgggcgagcggaggctggcacagaggaggcctcttcat
cccaccttgggtaaccccctgagtcgctctggtctcaaaggagtggatggagcctcttat
ttacgccacaaggagcggctcctgcgcatctccgttcgccacatggtgaaatcccaggtc
ttctactggattgtcttgagtttggtggctcttaacactgcctgtgtggccatcgtccat
cacaaccagccggcctggctcacacacttcctctactatgcagagttcctgtttcttggg
ctcttcctcctggagatgtccttgaagatgtatgggatggggccacgcctgtacttccat
tcttcattcaactgctttgactgtggggtcacagtgggaagcatctttgaagtggtttgg
gccatcttccgaccagggacctcttttgggatcagtgtcctacgagcccttcgtctcctg
cgaatatttaaaataaccaagtactgggcatccttgaggaatttggtggtctcgctgatg
agctccatgaagtctattatcagcctgctcttcttgctcttcctctttattgtagtcttt
gccctgctgggaatgcagctgtttggaggggggtttaatttcatcgatgggacaccatcg
gccaactttgacactttccctgcggccatcatgacggtgttccagatcttgacgggtgag
gactggaacgaggtgatgtacaatggcatccgctcccagggaggcgttcgctcgggcatg
tggtcctccatctatttcatcgtcctcaccttgtttgggaactatactctgctgaatgtc
ttcttggccattgcagtggacaacctggctaatgctcaggagctcaccaaggatgagcag
gaggaagaggaggcctttaaccagaagcatgcccttcagaaagccaaggaagtcagcccc
atgtctgcccccaacatgcctgctattgaaagagacaggcgcaggagacaccacatgtcg
atgtgggagccgcgcagcagccacctgcgggagcggcgccggaggcaccacatgtcggtg
tgggagcagcgcaccagccagctgcgtcgacacatgcagatgtccagccaggagggcatc
aataaggatgagccacccctcatcaacccacatgccagcatcttccgccgcaagaaacca
ggggacggcgttgccttggagaagtgcgatgaggagcaaggtggcaagggagagcggcct
ccggctgagggtcccgagcagccggccccagggaccaacccaggcggtggggaggacaga
aggagcccatcgccccgcgccaggagggacaaggagatgtggcaacacaaagcgtgccac
gggaactgcgagccgggtgaggaaggggcaggaggtggcatcgaggagagggcgcggatg
aggcaaagccagcggcgcagccggcatcgaaaagccaggatggaggggaaggagctgact
ggagccctggagagccgtgcgggcagccaggagatggggctggaggagccctgccctgca
gaggggatgcaggatggggagcggcgtggggatgctgccgcagcactggacctgattcaa
ggcgagccggaggcgagcagggaccccaccaggaccaatggggctccaaccgaggaggga
agcctcccagcatcagctcctgagcctgcccgggggatggagggcagcctgggcgagcag
gactgcagcagcccagacaccagtgagcaggccctgctggggggagcggcactgggggcc
agccgcactgtcagccacagcgagcctgacctgtcctccgtcaccgccaacactgaaaag
gccactgagagcaccaccatcatgattgatgtccaagactccactgtggtacagattagc
aacaagaccgatggagaagccagccccttgaaggaggctgagagcaaagaggatgaggag
gagatggagaagaagaagcggaagaaggagaagagcgagacaggcaaagcgatggtgcca
cacagctccatgttcatctttagcaccacaaacccggtgcgcagagcctgccactacatt
gtgaacctgcgctacttcgagatgtgcatcctgctggtcatcgccgccagcagcatcgcc
ctcgcggctgaggatcccgtcctcaccaactccgaccgtaacaaagtgctgaggtatttt
gactatgttttcactggtgtattcaccttcgagatggttatcaagatgatcgatcagggc
ttgatcctgcaggatggctcctacttccgagatctctggaacatcctagatttcatcgtg
gtggtgggagctctggtggccttcgccttggcgaccaacaagggtcgggatatcaagaca
atcaagtctctccgtgtgctgcgggtcttgaggcccctgaaaaccatcaagcggctgccg
aagctcaaggctgtcttcgactgcgttgtgacatccctcaagaacgttttcaacatcctc
attgtctacaagctcttcatgttcatctttgctgtcattgctgtccagctcttcaagggg
aagtttttctactgcactgacagctctaaagacacagagaaggactgcatagggaactac
gtggaccatgagaagaacaagatggaggtgaagtgccgggagtggaaacgacatgagttt
cactatgacaatataatctgggcgttgctcaccttgttcacagtctccactggcgagggt
tggccccaggtgctgcagcattcggtggatgtgacggaggaggaccgtgggcccagccgc
agtaaccgcatggagatgtccattttttacgttgtctattttgtggtcttccctttcttc
tttgtcaacatttttgtggctctcatcatcatcacgttccaagagcaaggagacaaaatg
atggaggagtgcagtctggagaagaatgagagggcctgtattgactttgccatcagtgcc
aagcccctcacacgctacatgccccagaaccggcacaccttccagtaccgggtctggcac
tttgtggtctccccatcctttgagtataccatcatggccatgattgctttgaacactgtg
gtgctgatgatgaagtactactctgctccatacacctatgagctggccctgaagtacctg
aacatcgctttcaccatggtgttctctttggagtgcgtccttaagatcattgcttttggc
tttctgaattatttccgggacacctggaatatctttgacttcatcaccgtcattggcagc
atcacagagatcatcctgacggacaccaagctggtgaacaccagcagcttcaacatgagt
ttcctgaaactcttccgggcggctcggctcatcaagctgctgcgccagggttacaccatc
cgcatcctgctgtggacatttgtgcaatccttcaaggctctcccctatgtctgcctccta
atcgcgatgcttttcttcatctatgccatcattgggatgcaggtttttggcaacatcaaa
ctagatgaggaaagccacattaaccggcacaacaacttccgcagcttcctgggctccctc
atgcttctcttcaggagtgccactggtgaggcatggcaggagatcatgctctcctgcctg
gagggcaagggctgcgagccagacacgacggcgacatccgggcagaatgagaacgagcgc
tgtggcaccgacctggcctacgtctattttgtctccttcatcttcttctgctcgttcctg
atgctcaacctgtttgtggcagtcatcatggacaattttgagtacctgacacgagattcc
tccatcctgggacctcaccatctagatgaatttgtccggatctgggcagagtatgacaga
gcagcgtgcggcaggatctcgtataaggatatgtacaaattagtacgggtgatctcgcct
cctctgggcctaggagagaactgcccctacagggtggcgtgcaagagactggtgctgatg
aacatgcccgtggctgaggacatgacagtccatttcacctccaccctgatggcgctgata
cgcaccgccctggacatcaaaattgccaaaggtggtgcagattggcagcagttagactct
gagcttcaaaaggagatcctgaccatttggcctcacctgtcccagaagatgctcgacctg
ttggtacctatgccaaaaacctctgacctgactgttggcaaaatatatgcagccatgatg
attatggattactacaagcagagcaaggcgaagaaacagaggcagcagctggaggagcag
aaaaacgcgcccatgttccagcgcatggagccatcctctttgccacaggaaatcatctcc
aacgcaaaggctctgccttacctccagcaggacactctcacaggactgagcagccggagt
gggttcccctcgctgagcccactctcaccacaggagatcttccagctggcgtgcatggat
ccagcccaggggcagttccaggagcaccagtctctggagccagaggttagggagtttcaa
agagtgcaaccctctaaccgtggcagctaccttcccgtggacactcaggaccacgctgtc
tctgggagggcctcctctatgcctcgtctcactgtggatccccaggtggtgacggacacc
agctcgatgcggcggtcgttttccaccatccgggacaaacgcaccaacacctcctggctg
gatgagttctccatggagcgcagcagtgacaacacctacaagtcccgccggcgcagctac
cactcctcgctccagctctctgcccggcgcctcaacgctgactcaggccacaggtccgag
gggcaccgctcaggcggcagggagaggggccgatccaaagagcgcaagcacttgctgtcc
cctgacatctcccgctgcaactcagaggagaggagtccccaggcacacgatgagtctcca
gagcggcggcgcgagtcccggtcccccagcgagggcaggtcgcaaacgcccaacaggcag
ggaacgggctccctgagtgaaagctccatcccctccatctcggacaccagcaccccccgg
cgaggccgccgccagctcccaccggtgcccccaaaaccgcgtcccctcctctcctacgcc
tccatgctgcggcacgccgccggagacgcctcaccacctcctgacgagaccgaagggggg
tccccgctcctctccaaggagcccaacgccgctggcctgaccgagtcttccagctcccca
gcggggaagccgagccggccatccaccccgcagcgttacatctcggagccctacctggcc
ctgcacgacgactcgcacgcctcggactgcggcgaggaggagacgctcactttcgaggcg
gccgtggccaccagcctgggtcgttccaacaccatcggctcagccccaccgctgcggcac
agctggcagatgcccaacgggcactaccggaggcggaggcgaggggccgggcagggtgtg
atgtgcggggccagcatcgacgtgctcagcgacaccgaggaagatgacaagtgctag

DBGET integrated database retrieval system