KEGG   Meleagris gallopavo (turkey): 100549528
Entry
100549528         CDS       T01523                                 

Gene name
SIAH1
Definition
(RefSeq) E3 ubiquitin-protein ligase SIAH1
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
mgp04120  Ubiquitin mediated proteolysis
mgp04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100549528 (SIAH1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100549528 (SIAH1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100549528 (SIAH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mgp04121]
    100549528 (SIAH1)
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100549528 (SIAH1)
Ubiquitin system [BR:mgp04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    100549528 (SIAH1)
SSDB
Motif
Pfam: Sina
Other DBs
NCBI-GeneID: 100549528
NCBI-ProteinID: XP_010716090
LinkDB
Position
13
AA seq 282 aa
MSRQTATALPTGTSKCTPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHL
VCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEEL
CEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVM
MQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP
RSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
NT seq 849 nt   +upstreamnt  +downstreamnt
atgagccgtcagactgctacagcactacctacaggtacttccaagtgtacgccatcacag
agagtgcctgcactgactggcactacagcttccaataatgacttggctagtctctttgag
tgtcctgtctgttttgactatgtgctgccaccaattcttcagtgtcagagtggccacctt
gtttgtagcaactgtcgccccaaacttacgtgctgtccaacttgccgaggcccgctgggc
tccattcgtaacctggctatggagaaagttgccaattctgtactattcccgtgtaaatat
gcctcttctggatgtgagataactctgccacacacagaaaaagcagaccatgaggagcta
tgtgagtttaggccttattcctgtccatgtcctggtgcttcatgtaaatggcaaggttct
ctggatgctgtaatgccacatctgatgcatcaacataagtcaattacaacacttcaggga
gaagatatagtgttccttgctacagacattaatcttcctggtgctgttgactgggttatg
atgcagtcttgttttggctttcatttcatgttagtattggaaaaacaggaaaaatatgat
ggtcaccagcagttctttgcgattgtacagctgataggaacacgcaagcaagcagaaaac
tttgcttatcgacttgagttaaatggtcataggcggcgactgacttgggaagcaactcct
cgatctatccatgagggaattgcaacagccattatgaatagtgactgtctagtctttgac
accagcattgcacagctctttgcagaaaatggcaatttaggcatcaacgtaactatatca
atgtgttga

DBGET integrated database retrieval system