KEGG   Mycobacterium haemophilum: B586_13915Help
Entry
B586_13915        CDS       T04111                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mhad  Mycobacterium haemophilum
Pathway
mhad00280  Valine, leucine and isoleucine degradation
mhad00650  Butanoate metabolism
mhad01100  Metabolic pathways
mhad01120  Microbial metabolism in diverse environments
Module
mhad_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mhad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    B586_13915
   00650 Butanoate metabolism
    B586_13915
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B586_13915
   00280 Valine, leucine and isoleucine degradation
    B586_13915
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B586_13915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mhad01007]
    B586_13915
Enzymes [BR:mhad01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     B586_13915
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     B586_13915
Amino acid related enzymes [BR:mhad01007]
 Aminotransferase (transaminase)
  Class III
   B586_13915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AKN17423
LinkDB All DBs
Position
complement(1751565..1752905)
Genome map
AA seq 446 aa AA seqDB search
MTSVEQSRQLVTEIPGPASRELAKRRVAAVSRGVGVTLPVFVTRAAGGIIEDVDGNRLID
LGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFMVTPYEEYVAVAEQLNRITPGSGEKRS
VLFNSGAEAVESSIKVARSYTRKPAVVAFDHAYHGRTNLTMALTAKSMPYKSGFGPFAPE
IYRAPLSYPYRDGLLNKDLATDGTLAGARAINVIERQVGADNLAAVIIEPIQGEGGFIVP
AAGFLATLLDWCHKNNVVFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLS
AVTGRAEIMDAPHVSGLGGTFGGNPVACVAALATITTIENDGLIERAQQIERLITDRLLR
LQAVDDRIGDVRGRGAMIAVELVKSGTADPDAELTEKVASAAHAAGVVVLTCGMFGNIIR
LLPPLTISDELLAEGLDILSRILDDL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcgtcgagcaaagccgtcagctggtcaccgaaatccccggccccgcatcacgt
gaactggcgaaacgccgcgtcgcggcggtgtctcgtggggtgggagtgaccctaccagtg
tttgtcacgcgcgccgccggcggcatcatcgaggacgtcgacggaaaccggcttatcgat
ctgggttctggaatcgccgtcaccaccatcggcaactcgtccccccgcgtcgtggacgcg
gtccgcgcgcaggtggccgacttcacccacacctgtttcatggtcacaccgtacgaggaa
tacgtcgccgtcgccgaacaactcaatcgaattaccccgggttccggcgagaaacgctcg
gtgctgttcaattccggcgccgaggcagtggagagctccatcaaggtcgcgcgttcgtac
actcgcaagcccgccgtggtcgcgttcgaccacgcctaccacggtcgcaccaacctgacg
atggcgctgaccgctaagtccatgccgtacaaaagcggctttggtccttttgcgccagag
atttaccgggcgccgctgtcctacccttatcgggacggcctgcttaacaaggacctcgcc
accgacggcacgttggccggcgcgcgggccatcaacgtcatcgagaggcaggtcggcgcc
gacaatctggctgctgtcatcatcgagccgatccagggcgaaggcggtttcatcgttccg
gccgcggggtttttggccaccctgctggattggtgccacaagaacaacgtggtgttcatc
gccgacgaggtgcaaacggggtttgcccgcaccggcgccatgttcgcctgcgagcacgac
ggaatcgtgcccgacctgatctgcaccgccaagggcatcgccgacggattgccgctgtcg
gcggtgaccggacgggcggagatcatggacgccccgcatgtcagcggcctgggcggcact
tttggcggcaacccggtcgcctgcgtggcagcgttggcaaccatcacgaccatcgagaac
gacggcctgatcgagcgagcccaacagatcgaacggctgatcaccgaccggttgttgcgg
ctgcaggccgtcgacgatcggatcggcgacgtgcgtggccgcggcgccatgatcgccgtc
gagttggtgaaatccggaacggctgaccccgacgccgagctgaccgagaaagtggccagc
gcggcgcacgccgccggcgtcgtcgtcttgacgtgtggcatgttcggcaacatcatccgg
ctgctgccgccgctgaccatcagcgacgaactgctggccgaaggccttgacatcctgagc
cgaatcctggacgacctctag

DBGET integrated database retrieval system