Mannheimia haemolytica 89010807N lktA-: VK67_02640 Help Entry VK67_02640        CDS       T03750                                  Name (GenBank) DNA-binding protein   KO K05787   DNA-binding protein HU-alpha Organism mhay  Mannheimia haemolytica 89010807N lktA- Brite KEGG Orthology (KO) [BR:mhay00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mhay03032]     VK67_02640    03036 Chromosome and associated proteins [BR:mhay03036]     VK67_02640    03400 DNA repair and recombination proteins [BR:mhay03400]     VK67_02640 DNA replication proteins [BR:mhay03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     VK67_02640 Chromosome and associated proteins [BR:mhay03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     VK67_02640 DNA repair and recombination proteins [BR:mhay03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       VK67_02640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 HU-CCDC81_euk_1 DUF2267 Motif Other DBs NCBI-ProteinID:  AKA13232 UniProt:  A0A248ZX64 LinkDB All DBs Position complement(512758..513030) Genome browser AA seq 90 aa AA seqDB search MNKTELIDAIAAGANLTKKDAKAALEATLDAISASLKAGDAVQLIGFGTFKVNERKARTG RNPKTGEEIKIAAAKVPAFVSGKALKDLVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaactgagttaatcgatgctatcgccgctggtgcaaacttaaccaagaaagat gctaaagcagcattagaagcaactcttgatgcaatctctgcaagcttaaaagcaggcgac gctgttcaattaatcggcttcggtacttttaaagtaaatgagcgtaaagcacgtactggt cgtaacccaaaaactggtgaagagatcaaaattgcagcagctaaagtacctgcattcgtt tcaggtaaagcattaaaagatttagtaaaataa

DBGET integrated database retrieval system