KEGG   Methanohalophilus halophilus: BHR79_02120
Entry
BHR79_02120       CDS       T04572                                 

Definition
(GenBank) 3-methylornithyl-N6-L-lysine dehydrogenase PylD
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mhaz  Methanohalophilus halophilus
Pathway
mhaz00300  Lysine biosynthesis
mhaz01100  Metabolic pathways
mhaz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mhaz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BHR79_02120
Enzymes [BR:mhaz01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     BHR79_02120
SSDB
Motif
Pfam: 2-Hacid_dh_C NAD_binding_2 NAD_binding_7 TrkA_N 3HCDH_N F420_oxidored adh_short UDPG_MGDP_dh_N ApbA
Other DBs
NCBI-ProteinID: APH38400
UniProt: A0A1L3Q0J6
LinkDB
Position
424360..425139
AA seq 259 aa
MALLTPQDLEGLTKQLECNNNTIKKATGMDIADICKQIYGTTLDGEKVGIVPITSGNGII
TNFSSSLLTITEYFGLDGAVTEHPDVTGYYEAVSSDADIILMADDHIFIAHNMRNGKIAT
NHVCTGVVYAEIASRYRYADSKDILVIGLGRVGYAGAQHLVKRDFDVYAYDPDRETMEKA
RKELGIIPYEPEEEHKFSMVLEATPNPNTISEGMVAERCLVSTPGIPCGLPEDIGERNEI
DLVMEPLMIGVASMLYAVM
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcactacttacaccacaagatctggaaggacttacaaagcaacttgagtgcaataac
aatactatcaaaaaagcaaccggaatggacattgctgacatatgcaaacaaatatatggc
accactcttgacggagaaaaggtaggtattgtgcctataacttccggtaacggtatcatt
accaatttttcatcatccctgcttacgataaccgaatatttcggccttgatggtgctgta
accgagcatcctgacgttaccggttactatgaagctgtttccagtgatgccgatataata
ctgatggcagatgaccacatttttattgcacataatatgagaaacggcaaaattgcaacc
aatcatgtatgcacaggcgtggtttacgctgaaatcgcctcccgttacagatatgccgac
tcaaaagatatacttgtaatcggcctgggaagagtgggttatgccggagcacaacatctt
gtaaaaagggatttcgatgtgtatgcctatgaccccgaccgggaaactatggaaaaagcc
cgcaaagaactgggcatcataccctacgaacccgaagaagaacacaagttctccatggtc
ctggaggctacaccaaaccccaatacgatctctgaaggcatggtggcagaaagatgcctc
gtatccacaccgggaatcccctgtggcttacctgaagacattggggaaaggaacgaaatc
gatctggtaatggaacctctgatgatcggcgtggcttcaatgctttatgctgtaatgtaa

DBGET integrated database retrieval system