KEGG   Methanosarcina horonobensis: MSHOH_3968
Entry
MSHOH_3968        CDS       T03933                                 

Definition
(GenBank) Proline reductase for pyrrolysine biosynthesis
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mhor  Methanosarcina horonobensis
Pathway
mhor00300  Lysine biosynthesis
mhor01100  Metabolic pathways
mhor01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mhor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MSHOH_3968
Enzymes [BR:mhor01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MSHOH_3968
SSDB
Motif
Pfam: NAD_binding_2 UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: AKB80451
UniProt: A0A0E3SGY8
LinkDB
Position
4857450..4858241
AA seq 263 aa
MALLTPEDLENINKQLQEADSSVRKVTGLDIKGICKDFYGTTPCCEKVGIVPVTSGNGII
GSFSASLHAITGYFGFDSFVTDMPDVSGYYEAVRNGAQIILMADDNTFLAHNLKNGKIAN
NQPCTGIIYAEIASRHLKADSKDVLAVGLGKVGFPGAAHFVHKGFRVYGYDADKALLEKT
VSSLGIIPFDPDNHSDNFRKFSIIFEATPCANTIPESVISENCVISTPGIPCAISKELQK
KYGVELIMEPLGIGTASMLYSVL
NT seq 792 nt   +upstreamnt  +downstreamnt
atggcacttttaaccccagaagatcttgaaaacattaacaagcagcttcaagaggctgat
tcctccgtcaggaaagttacagggctcgatataaaaggaatctgtaaagacttctacggc
acaaccccatgctgtgagaaagtaggtatcgtacctgtgacttcgggaaacgggattata
ggtagcttctcggcttccctgcatgcaattaccgggtatttcgggtttgacagtttcgtt
acggatatgcctgatgttagcgggtactacgaggcagtgagaaatggagcccaaataatc
cttatggcagatgacaatactttccttgcccacaacctgaaaaacggaaaaatagcaaac
aaccagccctgcacaggaataatctatgctgaaatagcttccagacacctgaaagcggac
tcaaaagatgttcttgccgttggccttggtaaagtaggctttccgggagcggcacacttc
gtacataaaggattcagagtttatggatacgatgcggataaagcccttctcgaaaagact
gtttccagtcttggaatcattccttttgatcctgacaaccacagtgacaatttcagaaaa
ttctccattattttcgaggcgactccctgtgcgaatacaattccagaatctgtgatttcg
gaaaattgtgtgatctctacaccgggaatcccctgtgcaatttcaaaggagttgcaaaag
aaatatggggtcgaactgataatggaaccccttggcatagggacggcatccatgctgtat
tccgtactctga

DBGET integrated database retrieval system