KEGG   Methanomethylovorans hollandica: Metho_0019
Entry
Metho_0019        CDS       T02418                                 

Definition
(GenBank) pyrrolysine biosynthesis protein PylD
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mhz  Methanomethylovorans hollandica
Pathway
mhz00300  Lysine biosynthesis
mhz01100  Metabolic pathways
mhz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mhz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Metho_0019
Enzymes [BR:mhz01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     Metho_0019
SSDB
Motif
Pfam: NAD_binding_7 3HCDH_N 2-Hacid_dh_C UDPG_MGDP_dh_N NAD_binding_2 TrkA_N F420_oxidored adh_short Shikimate_DH ApbA IlvN AlaDh_PNT_C Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: AGB48317
UniProt: L0KSD7
LinkDB
Position
complement(18494..19273)
AA seq 259 aa
MALLTPEDLDNLSAQFEESESTIERVTGTRLTDICKELYGKDLGSEKVGIIPITAGNGII
SNFTSSLLFIAQRLGLEGFITQHTDVAGYYEAIRDGADILLMADDHLFIAHNLRNGKLVT
NHEATGIIYSEIASRFKDSGSSEILVIGLGRVGYAGAKHLAEKGFDVYACDPNRDFLDKA
AHEIGIKEYCKEDRKKFSMVFEATPNANTITEGMIAERCLVSTPGIPCGLPQEVGGKYRV
DLVMEPLFIGVTSMLYSVI
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcattgctcacacccgaagaccttgataatctctctgctcaatttgaagagagtgag
tctaccattgaaagagttacaggaaccagacttacagatatctgcaaagaactctatgga
aaagacctgggatcggaaaaggttggtataatacccataaccgcaggtaatggaatcata
agcaattttacctcttccttgcttttcatagctcagcgccttgggcttgaaggtttcatt
actcagcatacagatgtggcaggatattatgaggctataagggatggcgcagatatacta
ttaatggctgatgatcatcttttcatcgctcacaatctcaggaatggaaaattggtcact
aaccatgaagcaacaggcatcatctattcagagatcgcttccaggtttaaggactcaggc
tcaagtgagatccttgttataggccttggaagagtaggatatgcaggagctaaacatctt
gcagaaaaagggttcgatgtttatgcctgtgatcctaacagagattttctggataaagca
gctcatgaaattggaattaaggaatactgcaaagaggatcgaaagaagttttccatggta
ttcgaagcaacacccaatgcaaacacaataaccgagggtatgatagcagagagatgtctg
gtctcaacacctggaataccctgtggattgcctcaggaagtcggaggtaaatacagagta
gatctagtcatggaacctctcttcataggagttacatctatgctttattcagtgatataa

DBGET integrated database retrieval system