KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_04971Help
Entry
MIP_04971         CDS       T02325                                 

Definition
(GenBank) Hypothetical protein
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00250  Alanine, aspartate and glutamate metabolism
mid00280  Valine, leucine and isoleucine degradation
mid00310  Lysine degradation
mid00410  beta-Alanine metabolism
mid00640  Propanoate metabolism
mid00650  Butanoate metabolism
mid01100  Metabolic pathways
mid01120  Microbial metabolism in diverse environments
Module
mid_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MIP_04971
   00650 Butanoate metabolism
    MIP_04971
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MIP_04971
   00280 Valine, leucine and isoleucine degradation
    MIP_04971
   00310 Lysine degradation
    MIP_04971
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MIP_04971
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mid01007]
    MIP_04971
Enzymes [BR:mid01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MIP_04971
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     MIP_04971
    2.6.1.48  5-aminovalerate transaminase
     MIP_04971
Amino acid related enzymes [BR:mid01007]
 Aminotransferase (transaminase)
  Class III
   MIP_04971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AFS15350
UniProt: J9WEB5
LinkDB All DBs
Position
3692134..3693477
Genome map
AA seq 447 aa AA seqDB search
MVAGLEQTRQLVTEIPGPLSLELSKRRAAAVSHAVNVSVPVFVARAGGGIIEDVDGNRLI
DLGSGIAVTTIGNSAPRVVDAVRAQVAEFTHTCFMVTPYESYVAVAETLNRITPGSGEKR
SVLFNSGAEAVENAVKVARAYTRKSAVVAFNHAYHGRTNLTMALTAKSMPYKAGFGPFAP
EVYRAPLSYPYRDGLIDKELATDGEKAAARAIRVIDSQIGADNLAALLIEPIQGEGGFIV
PAEGFLPTLLEWCRRNDVVFIADEVQTGFARSGAMFACEHEGIEPDLICTAKAIADGLPL
SAVTGRANIMDAPHVGGLGGTFGGNPLACAAALATIETIESDGLVERAQQLERLITEPLL
RLQAGDDRIGDVRGRGAMIAIELVKSGTAEPDKELTQKLTVAAQAAGVIVLTCGMFGNII
RLLPPLTIGDELLAEGIEILSGLLRDL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtggtggccggcctcgagcagactcgccaactggtcaccgagatccccggcccgctctcg
ctggaactgagcaagcgccgggcggcggcggtgtcgcacgcggtcaacgtctccgtcccc
gtcttcgtggcgcgcgccggcggcggcatcatcgaggacgtcgacggcaaccggctcatc
gacctcggctccggcatcgcggtgacgactatcggcaactcggcgccccgggtggtcgac
gcggtgcgcgcgcaggtcgccgagttcacccacacctgcttcatggtgacgccgtacgag
tcgtacgtcgcggtggccgagacgctcaaccggatcaccccgggctccggcgagaagcgc
tcggtgctgttcaattccggcgccgaggccgtcgagaacgccgtcaaggtcgcgcgcgcc
tacacgcgcaagtcggcggtggtggcgttcaaccacgcctaccacggccgcaccaacctg
acgatggcgctgaccgcgaagtccatgccctacaaggccggcttcggcccgttcgcgccg
gaggtctaccgggcgccgctgtcctacccctatcgggacggcctgatcgacaaggagctg
gccaccgacggggagaaggccgccgcgcgggccatccgggtcatcgacagccagatcggc
gccgacaacctggccgccctcctgatcgagccgatccagggcgaaggcgggttcatcgtg
ccggccgagggattcctgcccaccctgctggagtggtgccgcaggaacgacgtggtgttc
atcgccgacgaggtgcagaccggtttcgcgcgctcgggcgccatgttcgcctgcgaacac
gagggcatcgagcccgacctgatctgcaccgccaaggcgatcgccgacgggcttcccctg
tcggcggtcaccggccgggccaacatcatggacgcgccgcacgtcggcggcctcggcggc
accttcggcggcaaccccctggcctgcgcggcggcgttggccacgatcgagacgatcgag
agcgacgggctggtcgagcgggcccagcagctggaacggctgatcaccgaaccgctgctg
cggctgcaggccggcgacgaccggatcggcgacgtccgcggccgcggcgcgatgatcgcg
atcgagttggtgaagtcggggaccgccgagcccgacaaggagctgacccaaaagctgacc
gtcgccgcccaggccgccggcgtcatcgtcctgacctgcggcatgttcggcaacatcatc
cggctgctgccgccgctgaccatcggcgacgagttgctggccgagggaatcgagatcctg
agcgggttgttgcgcgacctgtaa

DBGET integrated database retrieval system