KEGG   Microbacterium sp. BH-3-3-3: BJP65_12860Help
Entry
BJP65_12860       CDS       T04827                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mih  Microbacterium sp. BH-3-3-3
Pathway
mih00250  Alanine, aspartate and glutamate metabolism
mih00280  Valine, leucine and isoleucine degradation
mih00310  Lysine degradation
mih00410  beta-Alanine metabolism
mih00640  Propanoate metabolism
mih00650  Butanoate metabolism
mih01100  Metabolic pathways
mih01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BJP65_12860
   00650 Butanoate metabolism
    BJP65_12860
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BJP65_12860
   00280 Valine, leucine and isoleucine degradation
    BJP65_12860
   00310 Lysine degradation
    BJP65_12860
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BJP65_12860
Enzymes [BR:mih01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BJP65_12860
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     BJP65_12860
    2.6.1.48  5-aminovalerate transaminase
     BJP65_12860
Amino acid related enzymes [BR:mih01007]
 Aminotransferase (transaminase)
  Class III
   BJP65_12860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOX46584
LinkDB All DBs
Position
2792422..2793834
Genome map
AA seq 470 aa AA seqDB search
MPATVQGGECGPRRRVRSIAAMSLDTLPTVGGPSLVQERRLVTAIPGPRSQELLDRKAAA
VASGVGHTVPIHAVAAGGGVVVDADGNSLIDLGAGIAVTSVGNAHPAVVKAVQDQVAAFT
HTCFMVSPYDSYVAVAEALNRLTPGDHEKKSALFNSGAEAVENAVKIARKHTGRQAVVAF
DHAYHGRTNLTMALTAKNMPYKSGFGPFAAEVYRAPLSYPFRDGLTGPEAAAKAISLIEK
QVGAENLAAVIIEPIQGEGGFIVPADGFLNAIVDWCRDNGVVFIADEVQSGFARTGAMFA
SELFGIVPDLVTTAKGIAGGLPLAAVTGRAEIMDATHTGGLGGTYGGNPIACAAALASID
AFENEGFLERAQQIGELLTRRLHELQANDPRVGDVRGHGAMIAAEFVDPTTGAPDAALTS
AVAKAAIAEGVIVLTCGTYGNVIRFLPPLSIGDELLNEGLDVVAAALLRN
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgcgactgtacaggggggagagtgcgggccgagacgccgcgtccgtagcatcgcc
gccatgagcctcgacaccctccccaccgtcggcggtccgtccctcgtccaggagcgccgc
ctcgtcaccgccatccccggcccccgctcgcaggagctcctcgaccgcaaggccgcggcc
gtggcatccggtgtcggccacaccgtccccatccacgcggtcgccgcgggcggcggagtc
gtcgtcgacgccgacggcaactcgctgatcgacctcggtgcgggcatcgcggtcaccagc
gtcggcaacgcccaccccgccgtcgtcaaggccgtccaggatcaggtcgccgccttcacc
cacacgtgcttcatggtgtcgccgtacgactcgtacgtcgccgtcgccgaggcgctcaac
cggctcacccccggcgaccacgagaagaagagcgcgctgttcaactccggcgccgaggcc
gtcgagaacgcggtcaagatcgcgcgcaagcacaccggccgccaggccgtcgtcgccttc
gatcacgcgtaccacggccgcaccaacctcacgatggcgctcacggccaagaacatgccg
tacaagagcggcttcggccccttcgccgccgaggtctaccgcgcgcccctgtcgtacccc
ttccgcgacggattgacgggccccgaggccgcggccaaggccatctcgctcatcgagaag
caggtcggcgccgagaatctcgccgccgtcatcatcgagcccatccagggcgagggcggc
ttcatcgtccccgccgacggattcctcaacgcgatcgtcgactggtgccgcgacaacggc
gtcgtcttcatcgccgacgaggtgcagtcgggcttcgcccgcaccggcgcgatgttcgcg
agcgagctgttcggcatcgtccccgacctcgtcaccaccgccaagggcatcgccggcggg
ctgccgctggcggccgtcaccggtcgcgccgagatcatggatgccacccacacgggcggt
ctcggaggcacctacggcggcaacccgatcgcctgcgccgcggccctggcctccatcgac
gccttcgagaacgaggggttcctcgagcgcgcgcagcagatcggcgagctgctcacgcgc
cgtctgcacgagctgcaggcgaacgacccgcgtgtcggcgacgtacgcggccacggcgcg
atgatcgcagccgagttcgtcgaccccaccaccggagcccccgacgccgccctcacctcg
gccgtggcgaaggccgcgatcgccgagggagtgatcgtgctcacgtgcggtacttacggc
aacgtcatccggttcctgccgccgctgtcgatcggcgacgagctgctgaacgaaggcctc
gacgtcgtcgcggccgccctgttgcgcaactga

DBGET integrated database retrieval system