KEGG   Microlunatus sp. KUDC0627: FOE78_02425Help
Entry
FOE78_02425       CDS       T06101                                 

Gene name
pknB
Definition
(GenBank) Stk1 family PASTA domain-containing Ser/Thr kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mik  Microlunatus sp. KUDC0627
Brite
KEGG Orthology (KO) [BR:mik00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mik01001]
    FOE78_02425 (pknB)
Enzymes [BR:mik01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     FOE78_02425 (pknB)
Protein kinases [BR:mik01001]
 Serine/threonine kinases: Other
  Bacterial family
   FOE78_02425 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Pkinase_fungal Kinase-like Kdo DUF4330 DUF4448 RIO1 Seadorna_VP7
Motif
Other DBs
NCBI-ProteinID: QDP94920
UniProt: A0A516PUW0
LinkDB All DBs
Position
complement(562318..564171)
Genome map
AA seq 617 aa AA seqDB search
MTQPETPAHRVVGGRYELGELLGRGGMAEVRRAVDNRLGRPVAVKELRTDLATDPTFQAR
FRREAQSAAGLNHPNIVAVYDTGEETDSATGVQIPYIVMELVEGPTLRDILREGRKILPE
RALELTVGVLDALTYSHRAGIVHRDIKPANVMLTQSGNVKVMDFGIARAVADTSATMTQT
AAVIGTAQYLSPEQARGETVDARSDLYSAGCLMYELLLGRPPFTGESPVSVAYQHVREAP
VPPSQLDPSISPEIDAIALKALAKEPDDRYQSAREMKSDINRVLAGEQATVALAPVGAAA
VAAEDADATRVVPATLPGSGPEDLDEEDEEPKKKRTGLVVGLIIAIVVVLAALGAGGWYW
WNSQHPQAAPPPPKVAVPSVKGMDRTRAESEIESKGLKASISNVNGADDATVNTAVEQSP
AAQTKVDPGSTVKVKINVGPKTATLPDDLVSMSAKKATAALEDAGFSADNIKKVKATQPE
PLDAKKNEVLAVDPDEGATVPVDTEVTLTVATGESQVPRLTGKLEDVAARDAEDAGFKTK
TKLVQDENNPVGSVVAQSIDAGELAPRGTTITISVVDERPTPPPTSSSPTNTATAKSTPS
DSGSPSPSDTTSPSKGG
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcccgagacaccggcgcaccgagtcgtgggtggccgatacgagctgggggaa
ctcctcggtcgtggcggcatggcggaggtacgccgtgccgtcgacaaccgtctcggccgc
ccggtggcggtcaaggaactccgcaccgacctggccaccgacccgaccttccaggcacgg
ttccggcgggaggcacaatcggccgccggcctgaatcatcccaacatcgtcgccgtctac
gacaccggcgaggagaccgattccgccaccggcgtgcagatcccgtacatcgtgatggag
ctggtcgagggtccgacgctgcgcgacatcctgcgtgagggccgcaagatcctgcccgaa
cgcgcgctggaactgaccgtcggcgtgctggatgcgctgacctacagccatcgcgccggg
atcgtgcaccgcgacatcaagccggccaacgtgatgctgacccaatccggcaacgtcaag
gtgatggacttcggcatcgctcgcgcggtcgccgacacctcggccaccatgacccagacc
gccgcggtgatcggcaccgcgcagtacctgtcgccggagcaggctcgcggcgagacggtc
gacgcccgcagcgacctctactccgccggctgtctgatgtacgagttgctgctcggccgg
ccgccgttcaccggcgagtcgccggtcagcgttgcctatcagcacgtccgcgaggcgccg
gtcccaccgagccagctggatccctcgatcagcccggagatcgacgcgatcgcgctgaag
gcgctggccaaggagcccgacgaccgctatcagtcggcccgggagatgaagtccgacatc
aaccgcgtcctcgccggtgagcaggccacggtcgcgctggcaccggtcggtgcagcggcg
gtggccgcagaggatgcggatgcgacccgggtggtgccggccacactgcccggctccggt
ccggaggatctggacgaggaggacgaggagccgaagaagaagcgcaccggtctggtcgtc
ggcctgatcatcgcgatcgtggtggtgctggccgcgctcggtgccggcggctggtactgg
tggaacagccagcatccgcaggccgcaccgccgccgccgaaggtggccgtcccgtcggtc
aaggggatggatcgcacccgggccgagtccgagatcgagtccaagggtctgaaggccagc
atcagcaacgtgaacggcgccgacgacgcgaccgtgaacaccgcagtcgagcagtccccg
gcggcgcagaccaaggtggacccgggttcgacggtgaaagtcaagatcaacgtcgggccg
aagacggcgaccctgccggacgatctggtcagcatgtcggcgaagaaggcgaccgccgca
ctggaggacgccggcttctccgccgacaacatcaagaaggtgaaggctacccagcccgaa
ccgctggacgcgaagaagaacgaggtgctcgcggtcgatccggacgagggcgcaacagtg
ccggtcgacaccgaggtcacgctcaccgtcgcgaccggtgagtcccaggtgccgcggctg
accggcaaactggaggacgtggccgctcgggacgccgaggacgccggcttcaagaccaag
accaagctggtccaggacgagaacaacccggtcggttcggtggttgcgcagagcatcgac
gccggcgaactggctccgcgcggcaccacgatcacgatcagcgtggtggacgagcgtccg
accccgccaccgacctcttcatcgccgaccaacacggccaccgcgaagagcacaccctcg
gattccggttcgccgagcccgtccgacaccaccagccccagtaagggcgggtag

DBGET integrated database retrieval system