KEGG   Microbacterium sp. CGR1: AKG07_06525
Entry
AKG07_06525       CDS       T04046                                 

Definition
(GenBank) acetylornithine aminotransferase
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
mim  Microbacterium sp. CGR1
Pathway
mim00220  Arginine biosynthesis
mim00300  Lysine biosynthesis
mim01100  Metabolic pathways
mim01110  Biosynthesis of secondary metabolites
mim01120  Microbial metabolism in diverse environments
mim01210  2-Oxocarboxylic acid metabolism
mim01230  Biosynthesis of amino acids
Module
mim_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
mim_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mim00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    AKG07_06525
   00220 Arginine biosynthesis
    AKG07_06525
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mim01007]
    AKG07_06525
Enzymes [BR:mim01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     AKG07_06525
    2.6.1.17  succinyldiaminopimelate transaminase
     AKG07_06525
Amino acid related enzymes [BR:mim01007]
 Aminotransferase (transaminase)
  Class III
   AKG07_06525
SSDB
Motif
Pfam: Aminotran_3 Aminotran_5
Other DBs
NCBI-ProteinID: AKV86005
LinkDB
Position
complement(1355299..1356510)
AA seq 403 aa
MSNWQDDAASDLVLNAGPRLAMLTRGEGSYLWDSEGKRHLDFLAGIAVTSLGHAHPVFVE
AVSRQAATLAHVSNYFATPWQLALAARLKRLAGAGIDGRVFFSNSGAEANEAAFKLARLH
GGTDKPRILALENGFHGRTMGSLALTAKAAMRAPFEPMPGGVEHIPATVEALEAAIDDRV
AAVIVEPIQGEAGVVELPDGYLQAARSLTLKHGALLIVDEIQTGAGRTGAWFGFSHEGIT
PDAITLAKGIGGGFPIGALVTYGAASSLFTPGSHGSTFGGNPLATAVADAVLTEIENAGL
VENAARRGEEIRQIIADIDSPLVTGVRGRGLLIGVALGAPVANDVVAAAQERGLIVNAAN
PETVRIAPALTIGDAELAEFRKLFADSLADVQTSLAESGKALA
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgagcaactggcaggatgacgcagcgagcgatctggtcctcaacgcgggcccgcgcctg
gcgatgctcacacgaggcgaggggtcctacctctgggactccgagggcaagcgccacctc
gacttcctcgccggcatcgcggtgacctcgctcggtcacgcgcacccggtgttcgtcgag
gccgtgtcgagacaggccgcgactctcgcgcacgtgtcgaactacttcgcgacgccctgg
cagctcgcgctcgccgcacggctgaagcgcctcgcgggcgccgggatcgacggccgcgtg
ttcttctcgaactccggcgccgaggcgaacgaagcggcgttcaagctcgcccgcctccac
gggggaacggacaagccacgcatcctcgcactcgagaacggattccacgggcgcaccatg
gggtcactcgcgctgacggccaaggccgcgatgcgcgcgccgttcgagccgatgcccggg
ggagtggagcacatcccggcgaccgtcgaggctctggaagccgcgatcgacgaccgggtc
gccgccgtcatcgtggagccgatccagggcgaggccggcgtggtcgagcttccggacggc
tatctgcaggccgcccgttcgctcacgctgaagcacggggcgctgctgatcgtcgacgag
atccagacgggtgccggacgcacgggggcctggttcggcttcagccacgagggcatcact
cctgacgcgatcacgctcgcgaagggcatcggcggaggcttcccgatcggcgctctcgtc
acctacggtgcggcgagctcgctcttcacgccgggttcgcacggatcgacgttcggcggc
aacccgctggccaccgccgtcgccgacgccgtgctcaccgagatcgagaacgccggactc
gtcgagaacgctgcgcgtcgaggcgaggagatccgacagatcatcgcggacatcgactcg
cccctcgtcaccggagtgcgtggccgagggctcctcatcggagtggcactcggcgccccc
gtcgcgaacgacgtggtcgccgccgctcaggagcgcggcctcatcgtgaacgcagccaac
cccgagacggtgcgcatcgccccggctctcacgatcggagacgctgaactcgccgagttc
cgcaagctcttcgccgattcgctcgctgacgtacagacatccctcgccgaatccggaaag
gccctcgcatga

DBGET integrated database retrieval system