KEGG   Mycolicibacter sinensis: JDM601_4158Help
Entry
JDM601_4158       CDS       T01512                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mjd  Mycolicibacter sinensis
Brite
Enzymes [BR:mjd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     JDM601_4158 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEF38158
UniProt: F5YUD5
LinkDB All DBs
Position
4440303..4440923
Genome map
AA seq 206 aa AA seqDB search
MADYTLPDLDWDYGALEPHISGQINELHHSKHHAAYVSGANSALAKLEEARANDDHGAIF
LNEKNLAFHLGGHVNHSIWWKNLSPNGGDKPTGELAAAIDDAFGSFDKFRAQFTAAANGL
QGSGWAVFGYDTLGGKLLTFQLYDQQANVPLGIIPLLQVDMWEHAFYLQYKNVKADYVKA
FWNVVNWADVQSRFAAATSKTSGLIF
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtggccgactacaccttgccggacttggactgggattacggagcccttgagccgcacatc
tcgggccagatcaacgaattgcaccacagcaagcaccacgccgcctatgtctccggcgcc
aacagcgcgctggccaagctcgaagaggcacgcgccaacgacgatcacggcgcgatcttc
ttgaacgagaagaacctggcgttccacctcggcgggcacgtcaaccactcgatctggtgg
aagaacctgtcccccaacggcggtgacaagcccaccggtgaactggccgctgccatcgat
gacgccttcgggtcgttcgacaagttccgcgcgcagttcaccgcggccgccaacgggctg
cagggttcgggctgggcggtgttcggctacgacaccctcggcggcaaactgctgaccttc
cagctctacgaccagcaggccaacgtgccgttgggcatcatcccgctgctgcaggtcgac
atgtgggagcacgctttctacttgcagtacaagaacgtcaaggcggactacgtcaaggcg
ttctggaacgtcgtcaactgggccgacgtacagtcccggttcgcggccgcaacctccaag
acctcgggtctgatcttctag

DBGET integrated database retrieval system