KEGG   Mycobacterium sp. JLS: Mjls_1596
Entry
Mjls_1596         CDS       T00482                                 

Definition
(GenBank) phthalate 3,4-dioxygenase, beta subunit
  KO
K18252  phthalate 3,4-dioxygenase subunit beta [EC:1.14.12.-]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00624  Polycyclic aromatic hydrocarbon degradation
mjl01100  Metabolic pathways
mjl01120  Microbial metabolism in diverse environments
mjl01220  Degradation of aromatic compounds
Module
mjl_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mjl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mjls_1596
Enzymes [BR:mjl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.-  
     Mjls_1596
SSDB
Motif
Pfam: Ring_hydroxyl_B SnoaL_4 SnoaL_2
Other DBs
NCBI-ProteinID: ABN97394
UniProt: A0A5Q5CE10
LinkDB
Position
1700022..1700621
AA seq 199 aa
MSVHDHQRIGQSAAPSVLGAHAARAQRVGDPLPFDDPRHLQAHSFLVNEAYLLDAQDYDR
WLGLLTEDIHYYMPVRITTAAGAGFDSSPGMAHFDENKYSLERRVARFATEHAWTEDPPS
RLRHFITNVRTFLSDDADHLVVDSAELLFRSRGDVNESTLISCGREDLLRRDGNALKLAR
RTICVDESVLRMQNLAVFL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgagcgttcacgatcaccagcgcattggtcaatccgcggctccatcggtgctcggggcg
cacgcggcgcgcgcccaacgcgtcggcgacccgttaccgttcgacgaccctcgtcacctc
caggcgcatagtttcctcgtcaacgaggcgtacctcctcgatgctcaagactacgaccgg
tggctgggtctgctcacagaggacatccactattacatgccggtgcggatcaccaccgcc
gcgggagccggatttgatagctcaccgggaatggcgcatttcgacgagaacaaatactca
cttgagcgccgggttgcccgtttcgccaccgagcatgcctggactgaggatccgccgtcg
cgtctgcgtcacttcatcaccaatgtgcgcacattcctcagcgacgatgccgaccacctc
gtggtcgacagcgctgagttgcttttccgcagccgtggcgacgtcaacgagtccacgctc
atctcatgtggtcgtgaagatcttctacgtcgcgatggcaacgcgctcaaactcgcacgc
cgaacaatctgcgtcgatgaatcagtgcttcgaatgcagaatctggcggtcttcctatga

DBGET integrated database retrieval system