KEGG   Mycobacterium sp. JLS: Mjls_2313Help
Entry
Mjls_2313         CDS       T00482                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase apoenzyme
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00250  Alanine, aspartate and glutamate metabolism
mjl00280  Valine, leucine and isoleucine degradation
mjl00310  Lysine degradation
mjl00410  beta-Alanine metabolism
mjl00640  Propanoate metabolism
mjl00650  Butanoate metabolism
mjl01100  Metabolic pathways
mjl01120  Microbial metabolism in diverse environments
Module
mjl_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mjl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Mjls_2313
   00650 Butanoate metabolism
    Mjls_2313
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mjls_2313
   00280 Valine, leucine and isoleucine degradation
    Mjls_2313
   00310 Lysine degradation
    Mjls_2313
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mjls_2313
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mjl01007]
    Mjls_2313
Enzymes [BR:mjl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Mjls_2313
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Mjls_2313
    2.6.1.48  5-aminovalerate transaminase
     Mjls_2313
Amino acid related enzymes [BR:mjl01007]
 Aminotransferase (transaminase)
  Class III
   Mjls_2313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABN98099
LinkDB All DBs
Position
complement(2413923..2415263)
Genome map
AA seq 446 aa AA seqDB search
MSTLEQSRHLATAIPGPKSQQLIDRKAAAVSRGVGTTMPVYAARAQGGIVEDVDGNRLID
LGSGIAVTTIGNAAPRVVEAVAAQAGRFTHTCFMVTPYEGYVAVAEALNRLTPGSGEKRS
ALFNSGSEAVENAVKIARSYTHKSAVVSFDHAYHGRTNLTMALTAKVMPYKHGFGPFAPE
IYRAPLSYPFRDAEFGKELATDGELAARRAIDVMDKQVGADNLAAVIIEPIQGEGGFIVP
AEGFLPTLLDWCRRNDVVFIADEVQTGFARTGRMFACEHEGIEPDLIVTAKGIADGMPLS
AVTGRAEIMDSPHVSGLGGTYGGNPVACAAALATIETIESENLVERAAAIGALMKDRLGR
LQAEDDRIGDVRGRGAMIAVELVKPGTTEPDAALAKALAAGAHTAGVIVLTCGTYGNVLR
FLPPLAISDELLDEGLDVVAGLLRDL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccctcgagcagagccgccacctcgccacggccatccccggcccgaagtcgcag
cagctcatcgaccgcaaggccgccgccgtctcacgcggtgtcggcaccacgatgccggtg
tacgcggcgcgtgcccagggcggcatcgtcgaggacgtcgacggtaaccggctgatcgac
ctgggctcgggtatcgcggtcaccacgatcggcaacgcggccccccgcgtcgtggaggcc
gtcgccgcgcaggccgggcggttcacccacacctgtttcatggtcacgccgtacgagggg
tacgtggcggtcgccgaggcgctcaaccggctcacccccggtagcggcgagaaacgctcg
gcgctgttcaactccggttcggaggccgtcgagaacgccgtcaagatcgccaggtcctac
acccacaaatccgcggtggtgtccttcgaccacgcctaccacggtcgcaccaacctgacc
atggcgctgaccgccaaggtgatgccctacaagcacgggttcggaccgttcgcgccggag
atctaccgcgcgccgctctcctaccccttccgcgacgccgaattcggtaaggaactggcg
accgacggcgaactggccgcccgccgggcgatcgatgtgatggacaagcaggtcggcgcc
gacaatctggccgcggtgatcatcgaaccgatccagggcgagggtggtttcatcgtcccg
gcggaaggcttcctgcccaccctgctcgactggtgccgccgcaacgacgtcgtgttcatc
gccgacgaggtgcagaccggattcgcccgcaccgggcggatgttcgcatgtgagcacgaa
ggcatcgaacccgacctcatcgtgacggccaagggcatcgccgacggtatgccgttgtcc
gcggtgacgggccgcgccgagatcatggactctccgcacgtgtcgggcctcggcggcacc
tacggcggcaacccggtcgcctgcgcggcggcactggccaccatcgagaccatcgaatcc
gagaacctcgtcgaacgcgcggcggcgatcggggcgttgatgaaggaccggctgggtcgg
ctgcaggccgaggacgaccgcatcggcgacgtgcgcggacgcggcgccatgatcgcggtg
gagctggtgaaaccgggcaccaccgaaccggacgccgccctggccaaggcgctggccgcc
ggtgcgcacaccgccggggtgatcgtgctgacgtgcggcacgtacggcaacgtgttgcgt
ttcctaccgccgttggccatcagcgacgagttgctcgacgaagggctcgacgtggtggcc
ggtctcctgcgcgacctctga

DBGET integrated database retrieval system