Metallosphaera javensis: MjAS7_0933 Help Entry MjAS7_0933        CDS       T07999                                  Name (GenBank) pyruvate synthase subunit PorD   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism mjn  Metallosphaera javensis Pathway mjn00010   Glycolysis / Gluconeogenesis mjn00020   Citrate cycle (TCA cycle) mjn00620   Pyruvate metabolism mjn00633   Nitrotoluene degradation mjn00640   Propanoate metabolism mjn00650   Butanoate metabolism mjn00680   Methane metabolism mjn00720   Carbon fixation pathways in prokaryotes mjn01100   Metabolic pathways mjn01110   Biosynthesis of secondary metabolites mjn01120   Microbial metabolism in diverse environments mjn01200   Carbon metabolism mjn01210   2-Oxocarboxylic acid metabolism Module mjn_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:mjn00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     MjAS7_0933    00020 Citrate cycle (TCA cycle)     MjAS7_0933    00620 Pyruvate metabolism     MjAS7_0933    00640 Propanoate metabolism     MjAS7_0933    00650 Butanoate metabolism     MjAS7_0933   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     MjAS7_0933    00680 Methane metabolism     MjAS7_0933   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     MjAS7_0933 Enzymes [BR:mjn01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      MjAS7_0933 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_21 Fer4 Fer4_7 Fer4_6 Fer4_2 Fer4_9 Fer4_10 Fer4_16 Fer4_4 Fer4_3 Fer4_17 Fer4_8 Fer4_13 Fer4_22 Fer4_15 Motif Other DBs NCBI-ProteinID:  BCS92325 LinkDB All DBs Position 740600..740857 Genome browser AA seq 85 aa AA seqDB search MSLEYQFFPVSHPSEGAGGKTGNWRVVRPVVGDRCIGCNACYLWCPEGTIGVKGRRAEVN YEYCKGCGVCANVCPVKAISMVSES NT seq 258 nt NT seq  +upstreamnt  +downstreamnt ttgtcgcttgaataccagttcttcccagtctctcatcccagtgagggagccgggggtaag accggtaactggagagtggtgagaccagttgttggcgacaggtgtattggctgtaacgcg tgttacctgtggtgcccggagggcaccattggggttaaggggagaagagctgaggtcaat tacgagtactgtaagggttgtggggtgtgcgccaatgtgtgtcccgtcaaggccatttcc atggtgagcgagtcgtga

DBGET integrated database retrieval system