Manis javanica (Malayan pangolin): 108386102 Help Entry 108386102         CDS       T06054                                  Symbol HMGB1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv03410   Base excision repair mjv04140   Autophagy - animal mjv04217   Necroptosis mjv04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:mjv00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     108386102 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108386102 (HMGB1)   09143 Cell growth and death    04217 Necroptosis     108386102 (HMGB1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     108386102 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mjv03036]     108386102 (HMGB1)    03400 DNA repair and recombination proteins [BR:mjv03400]     108386102 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mjv04147]     108386102 (HMGB1) Chromosome and associated proteins [BR:mjv03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     108386102 (HMGB1) DNA repair and recombination proteins [BR:mjv03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      108386102 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      108386102 (HMGB1) Exosome [BR:mjv04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    108386102 (HMGB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box HMG_box_2 NOA36 Nop14 Nucleo_P87 Radial_spoke PPP4R2 RNA_pol_3_Rpc31 DDHD Motif Other DBs NCBI-GeneID:  108386102 NCBI-ProteinID:  XP_036859797 LinkDB All DBs Position Unknown AA seq 164 aa AA seqDB search MSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRP KIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAA KKGVVKAEKSKKKKEEEEDEEDEEEEEEEEDEEEEDEEEDDDDE NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atgtctgctaaagagaaaggaaaatttgaagacatggcaaaggcagacaaggcccgttat gaaagagaaatgaaaacttacatccctcctaaaggggaaacaaaaaagaagttcaaggat cccaatgcccccaagaggcctccttcggcctttttcttgttttgttctgagtatcgccca aaaatcaaaggagagcatcctggcctatccattggtgatgttgcaaagaaactgggagag atgtggaataacactgctgcagatgacaagcagccttacgaaaagaaagccgctaagctg aaggaaaaatacgaaaaggatattgctgcataccgagctaaaggaaagcctgatgccgca aagaagggagttgtcaaggctgagaaaagcaagaaaaagaaggaagaggaggaagatgag gaagatgaggaggaggaggaggaggaggaggatgaggaggaggaagatgaggaggaagat gatgatgatgaataa

DBGET integrated database retrieval system