KEGG   Manis javanica (Malayan pangolin): 108386817
Entry
108386817         CDS       T06054                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01522  Endocrine resistance
mjv04010  MAPK signaling pathway
mjv04012  ErbB signaling pathway
mjv04024  cAMP signaling pathway
mjv04137  Mitophagy - animal
mjv04210  Apoptosis
mjv04310  Wnt signaling pathway
mjv04380  Osteoclast differentiation
mjv04510  Focal adhesion
mjv04530  Tight junction
mjv04620  Toll-like receptor signaling pathway
mjv04621  NOD-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04657  IL-17 signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04662  B cell receptor signaling pathway
mjv04668  TNF signaling pathway
mjv04722  Neurotrophin signaling pathway
mjv04912  GnRH signaling pathway
mjv04915  Estrogen signaling pathway
mjv04921  Oxytocin signaling pathway
mjv04926  Relaxin signaling pathway
mjv04932  Non-alcoholic fatty liver disease
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv05030  Cocaine addiction
mjv05031  Amphetamine addiction
mjv05132  Salmonella infection
mjv05133  Pertussis
mjv05135  Yersinia infection
mjv05140  Leishmaniasis
mjv05142  Chagas disease
mjv05161  Hepatitis B
mjv05162  Measles
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05169  Epstein-Barr virus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05203  Viral carcinogenesis
mjv05210  Colorectal cancer
mjv05211  Renal cell carcinoma
mjv05224  Breast cancer
mjv05231  Choline metabolism in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mjv05321  Inflammatory bowel disease
mjv05323  Rheumatoid arthritis
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108386817 (JUN)
   04012 ErbB signaling pathway
    108386817 (JUN)
   04310 Wnt signaling pathway
    108386817 (JUN)
   04668 TNF signaling pathway
    108386817 (JUN)
   04024 cAMP signaling pathway
    108386817 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    108386817 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    108386817 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108386817 (JUN)
   04530 Tight junction
    108386817 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108386817 (JUN)
   04621 NOD-like receptor signaling pathway
    108386817 (JUN)
   04625 C-type lectin receptor signaling pathway
    108386817 (JUN)
   04660 T cell receptor signaling pathway
    108386817 (JUN)
   04658 Th1 and Th2 cell differentiation
    108386817 (JUN)
   04659 Th17 cell differentiation
    108386817 (JUN)
   04657 IL-17 signaling pathway
    108386817 (JUN)
   04662 B cell receptor signaling pathway
    108386817 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    108386817 (JUN)
   04915 Estrogen signaling pathway
    108386817 (JUN)
   04921 Oxytocin signaling pathway
    108386817 (JUN)
   04926 Relaxin signaling pathway
    108386817 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108386817 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108386817 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108386817 (JUN)
   05203 Viral carcinogenesis
    108386817 (JUN)
   05231 Choline metabolism in cancer
    108386817 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108386817 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108386817 (JUN)
   05211 Renal cell carcinoma
    108386817 (JUN)
   05224 Breast cancer
    108386817 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    108386817 (JUN)
   05321 Inflammatory bowel disease
    108386817 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    108386817 (JUN)
   05031 Amphetamine addiction
    108386817 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108386817 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108386817 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108386817 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108386817 (JUN)
   05135 Yersinia infection
    108386817 (JUN)
   05133 Pertussis
    108386817 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108386817 (JUN)
   05170 Human immunodeficiency virus 1 infection
    108386817 (JUN)
   05161 Hepatitis B
    108386817 (JUN)
   05171 Coronavirus disease - COVID-19
    108386817 (JUN)
   05162 Measles
    108386817 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108386817 (JUN)
   05169 Epstein-Barr virus infection
    108386817 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    108386817 (JUN)
   05142 Chagas disease
    108386817 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108386817 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mjv03000]
    108386817 (JUN)
Transcription factors [BR:mjv03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    108386817 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch NBP1 TFIIA Fib_alpha DUF3450 Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 108386817
NCBI-ProteinID: XP_017500387
LinkDB
Position
Unknown
AA seq 333 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGNGSNGFSANLHSEPPVYANLSNFNPGA
LGSGGGAPSYSAAGLAFPAQPQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPGE
TPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTA
NMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag
tccgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccggtgggcagcctgaagccacacctccgggccaagaactcggacctc
ctcacttcacccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata
atccagtccagcaacgggcatatcaccaccacaccgacccccacccagttcctgtgcccc
aagaacgtgaccgacgagcaggagggcttcgctgagggctttgtgcgcgccctggccgaa
ctgcacagccagaacacattgcccagcgtcacgtcggctgcacagcccgtcagtggggcg
ggcatggtggcccccgcggtggcctcggtggcgggcggcaacggcagcaatggcttcagc
gccaacctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccgggcgcg
ctgggcagcggcggcggggcgccctcctacagcgcggcgggcctggcctttcccgcgcag
ccccagcagcagcaaccgccgcagccgccacaccacctgccccagcagatcccggtgcag
cacccgcggctgcaggccctgaaggaggagccgcagaccgtgcccgagatgcctggagaa
acgccgcccctgtctcccatcgacatggagtcccaggagcggattaaggcggagaggaag
cgcatgaggaaccgcatcgctgcctccaagtgccggaaaagaaagctggagaggatcgcc
cggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacggcc
aacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaacagt
gggtgccaactcatgctaacgcagcagttgcaaacattttga

DBGET integrated database retrieval system