Manis javanica (Malayan pangolin): 108386817 Help Entry 108386817         CDS       T06054                                  Symbol JUN Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv01522   Endocrine resistance mjv04010   MAPK signaling pathway mjv04012   ErbB signaling pathway mjv04024   cAMP signaling pathway mjv04137   Mitophagy - animal mjv04210   Apoptosis mjv04310   Wnt signaling pathway mjv04380   Osteoclast differentiation mjv04510   Focal adhesion mjv04530   Tight junction mjv04620   Toll-like receptor signaling pathway mjv04621   NOD-like receptor signaling pathway mjv04625   C-type lectin receptor signaling pathway mjv04657   IL-17 signaling pathway mjv04658   Th1 and Th2 cell differentiation mjv04659   Th17 cell differentiation mjv04660   T cell receptor signaling pathway mjv04662   B cell receptor signaling pathway mjv04668   TNF signaling pathway mjv04722   Neurotrophin signaling pathway mjv04912   GnRH signaling pathway mjv04915   Estrogen signaling pathway mjv04921   Oxytocin signaling pathway mjv04926   Relaxin signaling pathway mjv04932   Non-alcoholic fatty liver disease mjv04933   AGE-RAGE signaling pathway in diabetic complications mjv05030   Cocaine addiction mjv05031   Amphetamine addiction mjv05132   Salmonella infection mjv05133   Pertussis mjv05135   Yersinia infection mjv05140   Leishmaniasis mjv05142   Chagas disease mjv05161   Hepatitis B mjv05162   Measles mjv05166   Human T-cell leukemia virus 1 infection mjv05167   Kaposi sarcoma-associated herpesvirus infection mjv05169   Epstein-Barr virus infection mjv05170   Human immunodeficiency virus 1 infection mjv05171   Coronavirus disease - COVID-19 mjv05200   Pathways in cancer mjv05203   Viral carcinogenesis mjv05207   Chemical carcinogenesis - receptor activation mjv05208   Chemical carcinogenesis - reactive oxygen species mjv05210   Colorectal cancer mjv05211   Renal cell carcinoma mjv05224   Breast cancer mjv05231   Choline metabolism in cancer mjv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mjv05321   Inflammatory bowel disease mjv05323   Rheumatoid arthritis mjv05417   Lipid and atherosclerosis mjv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108386817 (JUN)    04012 ErbB signaling pathway     108386817 (JUN)    04310 Wnt signaling pathway     108386817 (JUN)    04668 TNF signaling pathway     108386817 (JUN)    04024 cAMP signaling pathway     108386817 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     108386817 (JUN)   09143 Cell growth and death    04210 Apoptosis     108386817 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     108386817 (JUN)    04530 Tight junction     108386817 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108386817 (JUN)    04621 NOD-like receptor signaling pathway     108386817 (JUN)    04625 C-type lectin receptor signaling pathway     108386817 (JUN)    04660 T cell receptor signaling pathway     108386817 (JUN)    04658 Th1 and Th2 cell differentiation     108386817 (JUN)    04659 Th17 cell differentiation     108386817 (JUN)    04657 IL-17 signaling pathway     108386817 (JUN)    04662 B cell receptor signaling pathway     108386817 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     108386817 (JUN)    04915 Estrogen signaling pathway     108386817 (JUN)    04921 Oxytocin signaling pathway     108386817 (JUN)    04926 Relaxin signaling pathway     108386817 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     108386817 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     108386817 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108386817 (JUN)    05207 Chemical carcinogenesis - receptor activation     108386817 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     108386817 (JUN)    05203 Viral carcinogenesis     108386817 (JUN)    05231 Choline metabolism in cancer     108386817 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     108386817 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     108386817 (JUN)    05211 Renal cell carcinoma     108386817 (JUN)    05224 Breast cancer     108386817 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108386817 (JUN)    05170 Human immunodeficiency virus 1 infection     108386817 (JUN)    05161 Hepatitis B     108386817 (JUN)    05171 Coronavirus disease - COVID-19     108386817 (JUN)    05162 Measles     108386817 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     108386817 (JUN)    05169 Epstein-Barr virus infection     108386817 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     108386817 (JUN)    05135 Yersinia infection     108386817 (JUN)    05133 Pertussis     108386817 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     108386817 (JUN)    05142 Chagas disease     108386817 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     108386817 (JUN)    05321 Inflammatory bowel disease     108386817 (JUN)   09165 Substance dependence    05030 Cocaine addiction     108386817 (JUN)    05031 Amphetamine addiction     108386817 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     108386817 (JUN)    05418 Fluid shear stress and atherosclerosis     108386817 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     108386817 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     108386817 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     108386817 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mjv03000]     108386817 (JUN) Transcription factors [BR:mjv03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     108386817 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha DUF3450 FlaC_arch TFIIA Motif Other DBs NCBI-GeneID:  108386817 NCBI-ProteinID:  XP_017500387 LinkDB All DBs Position Unknown AA seq 333 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGNGSNGFSANLHSEPPVYANLSNFNPGA LGSGGGAPSYSAAGLAFPAQPQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPGE TPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTA NMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg aacctggccgacccggtgggcagcctgaagccacacctccgggccaagaactcggacctc ctcacttcacccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata atccagtccagcaacgggcatatcaccaccacaccgacccccacccagttcctgtgcccc aagaacgtgaccgacgagcaggagggcttcgctgagggctttgtgcgcgccctggccgaa ctgcacagccagaacacattgcccagcgtcacgtcggctgcacagcccgtcagtggggcg ggcatggtggcccccgcggtggcctcggtggcgggcggcaacggcagcaatggcttcagc gccaacctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccgggcgcg ctgggcagcggcggcggggcgccctcctacagcgcggcgggcctggcctttcccgcgcag ccccagcagcagcaaccgccgcagccgccacaccacctgccccagcagatcccggtgcag cacccgcggctgcaggccctgaaggaggagccgcagaccgtgcccgagatgcctggagaa acgccgcccctgtctcccatcgacatggagtcccaggagcggattaaggcggagaggaag cgcatgaggaaccgtatcgctgcctccaagtgccggaaaagaaagctggagaggatcgcc cggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacggcc aacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaacagt gggtgccaactcatgctaacgcagcagttgcaaacattttga

DBGET integrated database retrieval system