KEGG   Manis javanica (Malayan pangolin): 108396268
Entry
108396268         CDS       T06054                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04010  MAPK signaling pathway
mjv04014  Ras signaling pathway
mjv04015  Rap1 signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04640  Hematopoietic cell lineage
mjv04916  Melanogenesis
mjv05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108396268 (KITLG)
   04014 Ras signaling pathway
    108396268 (KITLG)
   04015 Rap1 signaling pathway
    108396268 (KITLG)
   04072 Phospholipase D signaling pathway
    108396268 (KITLG)
   04151 PI3K-Akt signaling pathway
    108396268 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108396268 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    108396268 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108396268 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mjv04052]
    108396268 (KITLG)
Cytokines and growth factors [BR:mjv04052]
 Growth factors
  Growth factors (RTK binding)
   108396268 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 108396268
NCBI-ProteinID: XP_017514525
LinkDB
Position
Unknown
AA seq 274 aa
MKKAQTWIITCIYLQLLLLNPLVKAKGICRNRVTDDVKDVTKLVANLPKDYKITLKYVPG
MDVLPSHCWIREMVKQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEGHPL
ENIKKSSKSPEPRLFTPEEFFSIFNRSIDAFKDLKMVAPKISECMFSSTLSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKALNSMEDSSLQWAAIALPAFFSLVIGFAFGALYWKK
KQPNPTRAVENIQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaaggcacaaacttggattatcacttgcatttatcttcaactcctcctactgaat
cctctggtcaaagctaaaggaatctgcaggaaccgtgtcactgatgatgtgaaagacgtt
actaaattggtggcaaatcttccaaaggactataagataactctcaaatatgtccccggg
atggatgttttgcctagtcattgttggataagagagatggtgaaacaattatcagtcagc
ctgactgatcttctggacaagttttcaaatatttctgaaggcttgagtaattattctatc
atagacaaacttgtgaaaatagtggatgaccttgtggaatgcatggaaggacacccgttg
gagaatataaaaaaatcatctaagagcccagagcccaggctgtttactcctgaagaattc
tttagcatttttaatagatccatcgatgcctttaaggacttgaagatggtagcacctaaa
attagtgaatgcatgttttcttcaacattgagtcctgaaaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagctctcttaggaatgacagcagtagc
agtaataggaaggccttaaattccatggaagactccagcctacaatgggcagccatagca
ttgccagcattcttttctcttgtaattgggtttgcttttggagcattgtactggaagaag
aaacaaccaaatcctacaagggcagttgaaaatatacagattaatgaagaggataatgag
ataagtatgttgcaagaaaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system