KEGG   Manis javanica (Malayan pangolin): 108396495
Entry
108396495         CDS       T06054                                 

Gene name
TBX21
Definition
(RefSeq) T-box transcription factor TBX21
  KO
K10166  T-box protein 21
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    108396495 (TBX21)
   04659 Th17 cell differentiation
    108396495 (TBX21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    108396495 (TBX21)
Transcription factors [BR:mjv03000]
 Eukaryotic type
  Other transcription factors
   T-box
    108396495 (TBX21)
SSDB
Motif
Pfam: T-box T-box_assoc
Other DBs
NCBI-GeneID: 108396495
NCBI-ProteinID: XP_017514858
LinkDB
Position
Unknown
AA seq 535 aa
MGIVEPGCGDMLTGTEPMPASDEGRAPGADPQNRYFYPETGVQDSADRRGGASLGAPYAG
GALVPSPPGRFLGAYAYPPRPQASGFPGTGEPFPPTAGAEGYQPVDGYAVPDPRAGLYPG
PREDYALPAGLEVSGKLRVALNNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPT
SHYRMFVDVVLVDQHHWRYQSGKWVQCGKAEGSMPGNRLYVHPDSPNTGAHWMRQEVSFG
KLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVTDGEPEAACSASKTHIFTFQETQFI
AVTAYQNAEITQLKIDNNPFAKGFRENFESMYASVDTSIPSPPGPNCQLLGGDHYSPLLP
NQYPVPSRFYPDLPGQAKDVVPQPYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPAMSYY
RGQEVLAPGANWPVAPQYSPKMGPASWFRPMRTLPMEPGPGASEGRGPEDQGAPSVWTEI
TSIRLESNDSGLCEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKETEGQFYNYFPN
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgggcatcgtggagccgggctgcggagacatgctaacgggcaccgagccaatgccggcg
agcgacgagggccgggcgcctggcgccgacccgcagaaccgctacttctaccctgagaca
ggcgtgcaggactcggccgaccgtcgcgggggcgccagcctgggggcgccgtacgccggg
ggcgccctggtgccctccccgccaggccgcttcctcggagcctacgcctacccaccccgg
ccccaggcctccggcttcccagggacgggcgagcccttcccgccgaccgcgggcgccgag
ggctaccagcctgtggatggctacgcggtcccggacccgcgcgccggactctacccgggg
ccgcgcgaggactacgcgctgccggcagggctggaggtgtccgggaagctgagagtcgcg
ctcaacaaccacctgttgtggtccaagtttaatcagcaccagacggagatgatcatcacc
aagcagggacggcggatgttcccattcctgtcatttactgtggctgggctggagcccacc
agccattaccggatgtttgtggacgtggtcttggtggaccagcaccactggcggtatcag
agtggcaagtgggtgcagtgcggaaaggccgagggcagcatgccaggaaatcgcctgtac
gtccacccagattcccccaacactggagcccactggatgcgccaggaagtttcatttggg
aaactaaagctcacgaacaacaagggggcctccaacaatgtgacccagatgattgtgctc
cagtccctccataagtaccagccccggctgcacatcgttgaggtgacggatggagagcca
gaggcggcctgcagcgcttccaaaacgcatatcttcactttccaagaaacccagtttatt
gcggtgaccgcctaccagaacgcagagatcactcaactgaaaattgataataaccctttt
gccaaaggattccgggagaactttgagtccatgtatgcatctgtggacaccagcatcccc
tccccacctggacccaactgtcaattgcttgggggagaccactactctcctctcctaccc
aaccagtatcccgttcccagccgcttctaccccgaccttcctggccaggccaaggatgtg
gttccccagccttactggctgggggccccccgggaccacagctatgaggctgagtttcga
gcagttagcatgaagcctgctttcctgccctctgcccctgggcctgccatgtcctactac
cgaggccaggaggtcctggcgcctggagccaactggcctgtggccccccagtactctccc
aagatgggcccagccagctggttccgccccatgcggactctacccatggaacctggccct
ggagcttcagaggggcggggaccagaggaccagggcgccccctcagtgtggactgagatc
acctccatccggctagagtctaatgactcaggactgtgcgaaggagactctaagaggagg
cgtgtgtccccctatccttccagtggcgacagctcctcccctgctggggccccttctcct
tttgataaggaaaccgaaggccagttttataactattttcccaactga

DBGET integrated database retrieval system