KEGG   Manis javanica (Malayan pangolin): 108404796
Entry
108404796         CDS       T06054                                 

Gene name
ATP7A
Definition
(RefSeq) copper-transporting ATPase 1
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    108404796 (ATP7A)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108404796 (ATP7A)
Enzymes [BR:mjv01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     108404796 (ATP7A)
SSDB
Motif
Pfam: HMA Hydrolase E1-E2_ATPase Hydrolase_3 HAD_2 Hydrolase_6 3A Nitroreductase FXa_inhibition
Other DBs
NCBI-GeneID: 108404796
NCBI-ProteinID: XP_017528069
LinkDB
Position
Unknown
AA seq 1432 aa
MGFDAILHNPTPLPVLTDTVFLTVTASLAPLWDHIHSTLLKTKGVTDIKISPQQRTAVVT
IIPSIVNANQIIELVRDVSLDIATLEKKSGTCEDYCMAQAGEVILKMKVEGMTCHSCTST
IEGKIGKLQGVQRIKVSLDNQEATIVYQPHLITVEEIKKQIEAVGFSAFIRKQPKYLKLG
AIDIERLKNTPLKSSEGSQQRSPSYSNESAVTLIIDGMHCKSCVSNIESVLSTLQYVSNI
VVSLEGRSAIVKYNADSVTPETLRKAVEAISPGQYRVSIKSEVESTSNSPSSSSLQKIPL
KLVSQPLTQETVINIDGMTCNSCVQSVEDVISKKAGVKSIRVSLANGNGTVEYDPLLTSP
ETLREAIEDMGFDATLSDTNEPLVVIAQPSSEMPLLTSTNEFYTKVMTPVHDKEEAKTSS
KCYIQVTGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPPVIAELIRE
LGFGATVIENADEGDGVLELVVRGMTCASCVHKIESTLTKHRGIFYCSVALATNKAHIKY
DPEIIGPRDIIHTVESLGFEAALVKKDRSASHLDHKREIRQWRRSFLVSLFFCIPVMGLM
IYMMVMDHHLSTLHHNQNMSQEEMVNIHSSMFLERHILPGLSIMNLLSFLLCVPVQFFGG
WYFYVQAYKALKHKTANMDVLIVLATTVAFAYSLVILLVAMYERAKVNPITFFDTPPMLF
VFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLDSDNILLSEEQVDVELVQRGDII
KVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKSGSTVIAGSINQNGSLLIRATHVG
ADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVIISIVTLLVWIIIGFLNFEIVE
TYFPGYNRSISQTETVIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKG
GEPLEMAHKVKVVVFDKTGTITHGTPVVNQVKVLVEGNRISHSKILAIVGTAESNSEHPL
GAAITKYCKQELDTETLGTCIDFQVVPGCGISCKVTNIEGLLHKNNWKIEENNSKNASLV
QIDTSNEQSSTSSSMIIDAQLSNALNAQQYKVLIGNREWMIRNGLVISNIVDDSMTEHER
KGRTAVLVAVDDELCGLIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSKTARSIASQV
GINKVFAEVLPSHKVAKMKQLQEEGKQVAMVGDGINDSPALAMANVGIAIGTGTDVAIEA
ADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFMPIGLVLQPWM
GSAAMAASSVSVVLSSLFLKLYRKPTYENYELHARSQMGQKSPSEISVHVGIDDTSRNSP
KLGLLDRIVNYSRASINSLLSDKRSLNSAGTSEPDKHSLLVGDRWEDDDTTL
NT seq 4299 nt   +upstreamnt  +downstreamnt
atgggctttgatgctattctccacaatcctacccctctccctgttttaactgacactgtg
tttctaactgttactgcttcactggctcccctatgggaccatatccatagcacattgctc
aagaccaagggtgtgacagacattaaaatttcccctcagcaaagaacggcagtggtgaca
ataatcccttctatagtgaatgccaatcagataatagagctggttcgggatgtcagttta
gatattgcaactctggagaaaaagtcaggaacttgtgaagattactgtatggctcaagca
ggtgaagtcatactgaagatgaaagtggaagggatgacctgccattcatgcactagcacc
attgaaggaaaaattgggaagctgcaaggtgttcaacgaattaaagtctccctggacaac
caagaagctactattgtttatcaacctcatcttatcacagtagaggaaataaaaaagcag
attgaagctgtgggcttttcagcattcatcagaaaacagcccaagtacctcaaattggga
gctattgatatagaacgtctaaagaacacaccgctcaaatcctcagaaggatcgcagcag
aggagtccatcatatagcaatgagtctgcagtcactctcatcatagatggcatgcattgt
aaatcatgtgtatcaaatattgaaagtgttttatctacactccaatacgtaagcaacata
gtagtttctttagagggtagatctgccatagtgaagtataatgcagactcagtcactcca
gaaaccctgagaaaagcagtagaggccatatcaccagggcaatacagagttagtattaaa
agtgaagttgagagtacctcaaactctccctccagctcatctcttcaaaaaattcctttg
aaattagttagccagcctctgactcaagaaactgtgataaacattgatggcatgacttgt
aattcttgtgtgcagtctgttgaggatgtcatatcaaaaaaggcaggtgtaaaatctata
cgagtatcccttgcaaatggcaatgggactgttgaatatgatcctctactaacctctcca
gaaaccttgagagaagcaatagaagacatgggatttgatgctaccctgtcagatacaaat
gagcccttggtagtaatagcacagccctcatcagaaatgccacttttgacatcaactaat
gaattttatactaaagtgatgacaccagttcacgacaaggaggaggcaaagacttcatct
aagtgttacatacaggttactggcatgacttgtgcttcctgtgtagcaaacattgaacgg
aatttaagacgagaagaaggaatatattctgtacttgtggctctaatggctggcaaggca
gaagtaagatataatcctgcagttatacaacccccagtgatagctgagcttatccgagag
cttggatttggagccactgtgatagagaatgctgatgaaggggatggtgttttggaactt
gttgtgagaggaatgacgtgtgcctcctgtgtacataaaatagagtctaccctcacaaaa
cacagagggatcttctactgctctgtggccctggcaaccaacaaagcacatattaaatat
gatccagaaattattggtcccagagatattatccatacagttgaaagcttaggttttgaa
gctgctttggtcaagaaggatcggtcagcaagccacctagaccataaacgagaaataaga
caatggagacgttcattccttgtaagcctatttttctgtattcctgtaatgggcctcatg
atatatatgatggttatggaccaccacctttcaactctacaccataatcagaacatgagt
caagaagaaatggtcaacattcattcttctatgttcctggagcgccacatcctgccggga
ttgtccattatgaatttgctatcctttttattgtgtgtacctgtccagttttttggaggc
tggtacttctatgttcaggcctacaaagcactgaagcataaaactgcaaatatggatgta
ttgattgtgctggcaaccaccgttgcatttgcctactccttggttattcttctggttgca
atgtatgagagagccaaagtaaaccctattactttctttgacacacctcctatgctattt
gtgtttattgcattaggccggtggctggaacatatagcaaagggcaaaacatcagaagct
cttgccaagctaatttcactacaagctacggaagcaactattgtaactcttgactctgat
aatatcctcttgagtgaagaacaagtggatgtggaacttgtacaacgtggagacatcatt
aaagtggttccaggaggcaaatttccagtggatggtcgtgttattgagggacattctatg
gtagatgagtccctcatcacaggggaggcaatgcctgtggctaagaaatctggtagcaca
gtgattgctggttccattaaccagaatgggtcccttcttattcgcgcaacccatgttgga
gcagatacaaccctctctcaaattgtcaaacttgtagaagaggcacaaacatcaaaggct
cctattcagcagtttgcagacaaactcagtggctactttgttccatttattgttattatt
tccattgttaccctcttggtttggattataattggatttctgaattttgaaattgtggaa
acctactttcctggctacaaccgaagtatctctcaaacggaaacggtaatacgctttgcc
ttccaagcctctatcacagttctgtgcatcgcatgcccttgttccctgggactggccact
ccaactgctgtgatggtgggtacaggagtaggtgctcaaaatggcatactaatcaaaggt
ggtgagccactggagatggctcataaggtaaaggtagtggtatttgataagactggaacc
atcacccatggaaccccagtagtgaatcaagtaaaggttctggtggaaggtaacagaata
tcacacagtaagatcctggccattgtgggaactgctgaaagtaacagtgaacaccctctg
ggagcagccataaccaaatactgcaagcaggagctggacactgaaaccttgggtacctgc
atagatttccaggttgttccaggatgtggtattagctgtaaagtcaccaatattgaaggc
ttgctacataagaataattggaagatagaggaaaataatagtaaaaatgcatccctggtt
caaattgatacaagtaatgaacagtcatcaacttcgtcttccatgattattgatgcccag
ctctcaaatgctcttaatgctcaacagtacaaagtcctcattggtaaccgggagtggatg
attagaaatggtcttgtcattagtaacattgtagatgattccatgactgaacacgagaga
aaaggtcggactgctgtattggtggcagttgatgatgagctgtgtggcttgatagctatt
gctgatacagtgaagcctgaagcagaattggctgtccatattctgaaatctatgggctta
gaagtagttctgatgactggagacaacagtaaaacagctagatctattgcttctcaggtt
ggcattaataaggtgtttgctgaagttctaccttcccacaaggttgctaagatgaagcaa
cttcaagaggaggggaaacaggtagcaatggtgggagatggaatcaatgattccccagcc
ctggccatggctaatgtggggattgccattggtacaggcacagatgtagccattgaagca
gctgatgtggttttgataaggaatgatcttctggatgtcgtggcaagtattgacttatca
aggaagacagtcaaaaggattcggataaattttgtctttgctctaatttataatctggtt
ggaattcctatagctgctggagtttttatgcccattggtttggttttgcagccctggatg
ggatctgctgcaatggctgcttcctctgtttcagtagtactttcttctcttttccttaaa
ctttataggaaaccaacttatgagaattatgaactgcatgcccgaagccagatgggacag
aaaagtccttcagaaatcagcgttcatgttggaatagatgacacctcaagaaattctcct
aaactgggtttgctggaccggattgttaattacagcagagcctccataaattcgttgctt
tctgataaacggtctctaaacagcgctggtaccagtgaacctgacaagcactcactcctg
gtgggagaccgctgggaagatgacgacaccacattgtaa

KEGG   Manis javanica (Malayan pangolin): 108405458
Entry
108405458         CDS       T06054                                 

Gene name
ATP7B
Definition
(RefSeq) copper-transporting ATPase 2
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    108405458 (ATP7B)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108405458 (ATP7B)
Enzymes [BR:mjv01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     108405458 (ATP7B)
SSDB
Motif
Pfam: Hydrolase E1-E2_ATPase Hydrolase_3 Hydrolase_6 HAD HAD_2
Other DBs
NCBI-GeneID: 108405458
NCBI-ProteinID: XP_017529144
LinkDB
Position
Unknown
AA seq 666 aa
MSLQATEATVVTLGEDNLIVREEQVAVELVQRGDVIKVVPGGKFPVDGKVLEGSTMADES
LITGEAMPVTKRPGSTVIAGSINAHGSVLVSATHVGNDTTLAQIVKLVEEAQMSKAPIQQ
LADRFSGYFVPFIIIISTLTLVVWIIIGVTDFGVVQKYFPTPEHIPRAEVVVRFAFQTAI
TVLCIACPCSLGLATPTAVMVGTGVAAQNGVLIKGGKPLETAHKIKTVMFDKTGTITRGV
PEVMRVLLLVDVATLPLRKVLAVVGTAEASSEHPLGVAVTRYCKEELGTETLGYCTDFQA
VPGCGIGCRVSGVDGLLANGECPLSEPAAHLTRAGSAPEESAAPQTFSVLIGNREWMRRN
GLAVPGDVGDAMADHETKGQTAILVAIDGVLCGMIAIADAVKREAALAVHTLKSMGVDVV
LITGDNRKTARAIATQVGISKVFAEVLPSHKVAKVQELQSTGRKVAMVGDGVNDSPALAQ
ADVGIAIGTGTDVAIEAADVVLIRSDLLDVVASIHLSRRTVWRIRLNLVLALIYNLLGIP
IAAGVFMPFGVVLQPWMGSAAMAASSVSVVLSSLQLKCYKKPDLQRYQAQAQGRLKPLTP
SQVSVRVGMDDRRWDSPRATPWDQVSFASHVSLSSLRSDRLSRHSADDSGDKWSLLLSDR
DEEQCI
NT seq 2001 nt   +upstreamnt  +downstreamnt
atgtccctgcaagccacggaggccactgtcgtgacgcttggtgaggacaacttgatcgtc
agagaggagcaggtggccgtggagctggtgcagcggggcgatgtcatcaaggttgtcccc
gggggaaagttcccagtggacgggaaggtcctggaaggcagtaccatggccgacgagtcc
ctcatcacaggggaagccatgccggtcacgaagaggcccgggagcacagtgatcgccggg
tctataaacgcacacggctctgtgctcgtcagcgccacccacgtgggcaacgacaccacc
ttggctcagattgtgaagctggtggaagaagctcagatgtcaaaggcacccattcagcaa
ctggctgatcggttcagtggatattttgtcccatttatcatcatcatttcaactttgacg
ttggtggtatggattataatcggtgttaccgattttggtgttgttcagaaatactttcct
acccccgagcacatcccccgggcagaggtggtcgtccggttcgcgttccagacggccatc
acggtgctgtgcatcgcctgcccttgctctctgggcctggccacgcccacggcggtcatg
gtgggcaccggcgtggcggcgcagaacggcgtcctcatcaagggaggcaagcccctggag
acggctcacaagataaagactgtgatgtttgacaagaccggcaccatcacccgtggggtc
cccgaggtcatgcgggtcctcctgctggtggacgtggccacgctgcccctcaggaaggtt
ctcgctgtcgtggggacagcggaggccagcagcgagcacccgctgggcgtggctgtcacc
agatactgtaaagaggaacttgggacagagaccctggggtactgcacagacttccaggca
gtgccaggctgtggaatcggctgcagggtcagcggcgtggatggcctcctggccaacggc
gagtgcccgctgagtgagccggctgctcacctgaccagggctggcagtgctcccgaggaa
tcagcagctccccagaccttctctgtgctgatcggaaaccgcgaatggatgaggcgcaat
ggcctagccgtgcccggcgacgtcggcgacgccatggcggaccacgagacgaaaggccag
accgccattctggtggcgatcgacggtgtgctgtgtggcatgatcgccatcgcggatgct
gtcaagcgggaggcggccctggccgtgcacacgctgaagagcatgggtgtggacgtggtt
ctgatcacaggggacaaccggaagacagccagagccattgccacccaggtgggcatcagc
aaagtcttcgcagaggtgctgccctcccacaaggtggccaaggtgcaggagctgcagagc
acgggcaggaaggtcgccatggtcggggacggggtgaacgactccccggccttggcccag
gccgacgtgggcatcgccatcggaacgggcacggacgtcgccatcgaggcagccgacgtc
gtcctcatcagaagcgatctgctcgatgtggtggccagcatccacctgtccaggaggacc
gtctggagaatacggctcaatctggtgctggcgctcatctacaacctgctcgggataccc
attgcagcaggtgtcttcatgcccttcggcgttgtgctgcagccatggatgggatcggcg
gccatggcggcctcctccgtgtctgtggtcctgtcctcactgcagctcaagtgctataag
aagcctgacctgcagaggtaccaggcccaggcccagggccgcctgaagcccctgaccccg
tcgcaggtcagcgtgcgcgtgggcatggacgaccggcggtgggactcgccccgggccacg
ccctgggaccaggtcagcttcgccagccacgtgtccctgtcctccctgcggtccgacagg
ctgtctcggcacagcgctgacgacagtggggacaagtggtctctgctcctgagtgacagg
gacgaggagcagtgcatctga

KEGG   Manis javanica (Malayan pangolin): 108407744
Entry
108407744         CDS       T06054                                 

Definition
(RefSeq) copper-transporting ATPase 2-like
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01524  Platinum drug resistance
mjv04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    108407744
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108407744
Enzymes [BR:mjv01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     108407744
SSDB
Motif
Pfam: HMA
Other DBs
NCBI-GeneID: 108407744
NCBI-ProteinID: XP_017532789
LinkDB
Position
Unknown
AA seq 714 aa
MEGAGAETARVPGQPLLTTLGDPQGTLRSGHRRWSFRRSPRARGPTGPEEGESSREVPSG
AQHVGASQDLSKLSLPARAQEPAMKQSFAFDNAGYEDGLPGVHPSQMAIGTTRVLGMTCQ
SCVKSIEGRISRLKGIVSIRVSLEQGSATVKYVPSVVSLSQVCRQIEDMGFKASVVEGRA
ASWPSRSSPAPEAVVKLRVEGMTCQSCASSIEGELGRLQGVSRVRVSLGSREAVVTYQPG
LIQPRDLRDRVNDMGFEAAIKTKVAPLSLGPIDVGRLQSANPETPPAPTNQNLSNPETLG
HRGSRVVTLNLSIDGMHCKSCVLNIEENIGQLPGVQNIQVSLENRTAQVQYDPARISPAA
LQRAVEALPPGNFKVFLPDGADGSGADDPPPACRWGPTPGSQAQGVSCSVGLAIGGMTGT
SCVQAIEGLVAQREGVQRISVSLSEGTETVLYDPSAITPEELRGAVDNMGFEASVISENC
SSNHVGNHTAGSSVVPAAACTPVPVWEAAPHAGHSPGRLTAPRACTTVEPQKCFLQVTGM
TCASCVSHIERSLQKEADASLEKETCYVRGGSCWLQTVPPRGLPQRRPPEPDGVAAAGLG
LGGGPLGLGRGMTTKAPGGTPAPPPASVAVPLLQISGMTCASCVRNIEARLSRAAGVTHA
SVALATSRARVRFDPEVIGPRDIVNIIEGIGFGASPAQRTPSAHHLDHKGEIKQ
NT seq 2145 nt   +upstreamnt  +downstreamnt
atggagggagctggggccgagacagcccgggtccccgggcagcccttgctcacgactctg
ggtgacccacaggggaccctgcggtccgggcacaggcggtggtccttcaggaggagccct
cgggccaggggccccaccgggcccgaggagggagaatcttcacgggaggttccgagtgga
gctcagcacgtcggtgccagccaggacctctccaagctgtctctacctgctcgtgcccag
gagccagcaatgaagcagagcttcgccttcgacaacgctggctacgaggacgggctgccc
ggggtgcacccttcccagatggccatcggcaccacccgcgttttgggcatgacatgccag
tcctgtgtgaagtccatcgagggccggatttccaggttgaaaggcattgtgagcatccgg
gtttccctggaacagggcagcgccactgtgaaatatgtgccgtcggtcgtgagcctctcg
caggtgtgccgtcaaattgaggacatgggcttcaaggccagcgtcgtggaaggaagggct
gcctcctggccctcgaggtcctcacctgccccggaggccgtggtcaagcttcgggtggag
ggcatgacctgccagtcctgcgccagctccatagaaggagagctcgggagactgcaggga
gtcagcagggtcagagtgtcgctcggcagccgggaggcggtcgtcacctaccagcctggt
ctcattcagccccgagacctcagggaccgcgtgaatgacatgggcttcgaagctgccatc
aagaccaaggtggctcccctgagcctggggcccattgatgttgggcggctgcaaagcgcc
aacccagagacacccccggcccccaccaaccagaatctcagtaaccccgagactctgggc
caccgaggcagccgtgtggtcaccctgaacctgagcatagatggaatgcactgtaagtct
tgtgtcctgaatattgaagagaatataggccaactcccaggggttcaaaatatccaagtg
tccttggagaacagaacggcccaagttcagtatgaccccgcccggatctccccagcggcc
ctgcagagggctgtggaggctcttccccctgggaacttcaaggtctttcttcctgacgga
gccgacgggagtggggcagatgacccgcctcctgcgtgtcgctggggcccgaccccaggc
agccaggcacaaggcgtgagctgctccgtgggccttgccatcggcggcatgactggcacg
tcctgtgtccaggccatcgagggcctcgtcgcccaaagggaaggggtgcagcggatatca
gtgtccttgtctgaagggaccgaaacggttctctatgacccctctgcgatcaccccagaa
gagctgcgaggtgctgtggacaacatggggtttgaagcttctgtcatttctgaaaactgc
tctagcaaccatgtgggaaaccacacagcggggagttccgtggtgccagctgcagcgtgc
acacctgtgccagtgtgggaagcggctccccacgctggccacagtcctggccgcttgacg
gccccgcgagcctgcaccacagtggagccacagaagtgcttcttacaggtgacgggcatg
acctgtgcctcctgcgtgtctcacatagagagaagcctgcagaaggaggccgacgcgtct
ctggagaaagaaacctgctatgtgcgtggtggcagctgctggctacagaccgtccctccg
cgggggctgccccagaggcgccctccagagcccgacggagtggccgcagcaggcctgggg
ctgggtggggggcccctgggcctgggccgtggaatgaccaccaaagccccagggggcacc
ccagccccgcccccggccagcgtggctgtccccctgctgcagatctccggcatgacctgc
gcatcctgcgtccgcaacatcgaggccaggctctcgcgggcggctggcgtcacccacgcc
tctgtggcactcgccaccagcagggcccgcgtgaggtttgaccccgaagtcatcggccca
cgagacattgtcaacattatcgagggaatcggctttggagcctctccggcccagagaacg
cccagcgctcatcacttggaccacaagggggaaataaagcagtag

DBGET integrated database retrieval system