KEGG   Manis javanica (Malayan pangolin): 108406768
Entry
108406768         CDS       T06054                                 

Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 2-like
  KO
K18026  tyrosine-protein phosphatase non-receptor type 2 [EC:3.1.3.48]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108406768
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mjv01009]
    108406768
Enzymes [BR:mjv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     108406768
Protein phosphatases and associated proteins [BR:mjv01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    108406768
SSDB
Motif
Pfam: Y_phosphatase
Other DBs
NCBI-GeneID: 108406768
NCBI-ProteinID: XP_017531157
LinkDB
Position
Unknown
AA seq 261 aa
GPLPNTGCHFWLMVWQQKTKAVVMLNRIVEKESVKCAQYWPTKDDREMLFKETGFSVKFL
SEDVKSYYTXFSVKFLSEDVKSYYTVHLLQLGNINTGETRTISHFHYTTWPDFGVPESPA
SFLNFLFKVRESGSLNPEHGPAVIHCSIGRSGTFSLVDTCLVLMEKGDDINIKQLLLNMR
KYRMGLIQTPDQLRFSYMTIIEGAKFIRGDSNIQKQWKELSKEDLCPAFDHSPNKIMTEK
YNGNRIGLEEEKLTGDRYTGL
NT seq 782 nt   +upstreamnt  +downstreamnt
ggtccacttccaaatacaggttgtcatttctggctcatggtgtggcaacaaaagactaaa
gcagttgtcatgctaaaccgaattgtggagaaagaatccgttaaatgtgcacagtactgg
ccaacaaaagacgaccgagagatgctgtttaaagaaacaggattcagtgtgaagttcttg
tccgaagatgtgaagtcatattatacagnattcagtgtgaagttcttgtccgaagatgtg
aagtcatattatacagtgcatcttctgcaattaggaaatatcaatactggggagaccaga
acaatatctcactttcattatactacctggccagattttggagtccctgaatcaccagct
tcatttctcaatttcttatttaaagtgagagaatctggttccttgaatcctgagcatggg
cctgcagtgatccactgtagcattgggcggtcaggcaccttttctctagtagatacctgt
cttgttctgatggaaaaaggagatgatattaacattaagcagctgttactgaatatgaga
aaatatcgaatgggacttattcagacaccagatcaactcagattttcatatatgactata
atagaaggagcaaaatttataaggggagattcaaatatacagaaacaatggaaagaactt
tcaaaggaagatttgtgtcctgcttttgatcattcaccaaacaaaataatgactgaaaaa
tacaatgggaatagaataggcctagaagaagaaaaactgacaggtgacagatatacagga
ct

DBGET integrated database retrieval system