KEGG   Manis javanica (Malayan pangolin): 108407571
Entry
108407571         CDS       T06054                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death isoform X1
  KO
K02158  Bcl-2-antagonist of cell death
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv01522  Endocrine resistance
mjv01524  Platinum drug resistance
mjv04012  ErbB signaling pathway
mjv04014  Ras signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04024  cAMP signaling pathway
mjv04062  Chemokine signaling pathway
mjv04140  Autophagy - animal
mjv04151  PI3K-Akt signaling pathway
mjv04210  Apoptosis
mjv04370  VEGF signaling pathway
mjv04510  Focal adhesion
mjv04722  Neurotrophin signaling pathway
mjv04910  Insulin signaling pathway
mjv04919  Thyroid hormone signaling pathway
mjv05010  Alzheimer disease
mjv05014  Amyotrophic lateral sclerosis
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05162  Measles
mjv05165  Human papillomavirus infection
mjv05168  Herpes simplex virus 1 infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05200  Pathways in cancer
mjv05203  Viral carcinogenesis
mjv05210  Colorectal cancer
mjv05211  Renal cell carcinoma
mjv05212  Pancreatic cancer
mjv05213  Endometrial cancer
mjv05215  Prostate cancer
mjv05218  Melanoma
mjv05220  Chronic myeloid leukemia
mjv05221  Acute myeloid leukemia
mjv05223  Non-small cell lung cancer
mjv05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108407571 (BAD)
   04014 Ras signaling pathway
    108407571 (BAD)
   04370 VEGF signaling pathway
    108407571 (BAD)
   04024 cAMP signaling pathway
    108407571 (BAD)
   04022 cGMP-PKG signaling pathway
    108407571 (BAD)
   04151 PI3K-Akt signaling pathway
    108407571 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108407571 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    108407571 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108407571 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    108407571 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108407571 (BAD)
   04919 Thyroid hormone signaling pathway
    108407571 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108407571 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108407571 (BAD)
   05203 Viral carcinogenesis
    108407571 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108407571 (BAD)
   05212 Pancreatic cancer
    108407571 (BAD)
   05225 Hepatocellular carcinoma
    108407571 (BAD)
   05221 Acute myeloid leukemia
    108407571 (BAD)
   05220 Chronic myeloid leukemia
    108407571 (BAD)
   05218 Melanoma
    108407571 (BAD)
   05211 Renal cell carcinoma
    108407571 (BAD)
   05215 Prostate cancer
    108407571 (BAD)
   05213 Endometrial cancer
    108407571 (BAD)
   05223 Non-small cell lung cancer
    108407571 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108407571 (BAD)
   05014 Amyotrophic lateral sclerosis
    108407571 (BAD)
   05020 Prion disease
    108407571 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    108407571 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108407571 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108407571 (BAD)
   05161 Hepatitis B
    108407571 (BAD)
   05160 Hepatitis C
    108407571 (BAD)
   05162 Measles
    108407571 (BAD)
   05168 Herpes simplex virus 1 infection
    108407571 (BAD)
   05165 Human papillomavirus infection
    108407571 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108407571 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108407571 (BAD)
   01524 Platinum drug resistance
    108407571 (BAD)
   01522 Endocrine resistance
    108407571 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 108407571
NCBI-ProteinID: XP_017532482
LinkDB
Position
Unknown
AA seq 193 aa
MRTPENLSSASTHATAGGSHEPRAQSMFQIPEFEQSEQEDSNPADRGLGPSPTRDRPPGP
SKHRYVAPGLLGEAGHQQGQRASSSHHGGAGAGETRSRHSSYPAGTEENEEEEEEPSPFR
GRSRSAPPNLYAAQRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWTRIIQSWW
DRNLWRGGSAPSQ
NT seq 582 nt   +upstreamnt  +downstreamnt
atgaggaccccagagaatctctcatctgcttccacacacgccacagcaggaggaagtcat
gagccaagagcccagagcatgttccagatcccagagtttgagcaaagtgagcaggaagac
tccaaccctgcagacaggggcctgggccccagccccaccagggaccgaccccctggcccc
agcaagcaccggtacgtagccccaggcctcctgggggaagctggtcaccagcaagggcag
cgggccagcagcagccatcatggaggcgcaggcgctggggagacgcggagtcgccacagc
tcgtaccccgcagggaccgaggagaatgaagaggaggaggaggaacccagtcccttccgg
ggccgctcgcgctcggcgccccccaacctctacgctgcgcagcgctatggccgcgagctc
cggaggatgagcgacgagttccagggatcattcaagggacttcctcgcccgaagagcgca
ggcacagctacgcaaatgcggcagagccccagctggacacgcatcatccagtcctggtgg
gatcgaaatttgtggagaggaggttccgccccctcccagtga

DBGET integrated database retrieval system