KEGG   Manis javanica (Malayan pangolin): 108409236
Entry
108409236         CDS       T06054                                 

Gene name
BMPR1A
Definition
(RefSeq) bone morphogenetic protein receptor type-1A
  KO
K04673  bone morphogenetic protein receptor type-1A [EC:2.7.11.30]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv04060  Cytokine-cytokine receptor interaction
mjv04350  TGF-beta signaling pathway
mjv04390  Hippo signaling pathway
mjv04550  Signaling pathways regulating pluripotency of stem cells
mjv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108409236 (BMPR1A)
   04390 Hippo signaling pathway
    108409236 (BMPR1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108409236 (BMPR1A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    108409236 (BMPR1A)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108409236 (BMPR1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108409236 (BMPR1A)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mjv04090]
    108409236 (BMPR1A)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     108409236 (BMPR1A)
Protein kinases [BR:mjv01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   108409236 (BMPR1A)
CD molecules [BR:mjv04090]
 Proteins
  108409236 (BMPR1A)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TGF_beta_GS Activin_recp Pkinase_fungal FTA2
Other DBs
NCBI-GeneID: 108409236
NCBI-ProteinID: XP_017535182
LinkDB
Position
Unknown
AA seq 532 aa
MTQLYIYIRLLGAYLFIISHVQGQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLK
CYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRR
TIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRWLVVLISMAVCIIAMIVFSSCFCYKHYC
KSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQV
GKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTG
SWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAH
RDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKN
HFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPNDPSYEDMREVVCVKRLR
PVVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgactcagctatatatttatatcagattattgggagcctatctattcatcatttctcat
gttcaagggcagaatctagacagtatgctccatggtactgggatgaaatcagactctgac
cagaagaagtcagaaaatggagtaaccttagcaccagaggatactttgccttttttaaag
tgctactgctcaggacactgcccggatgatgctattaataacacatgcataactaatggg
cattgttttgccataatagaagaagatgaccagggagaaaccacattagcttcaggttgt
atgaaatatgaaggatctgattttcagtgcaaggattcaccaaaagcccagctacgccgc
acgatagaatgttgtcggaccaatttatgtaatcagtatttacagcctacactgccccct
gttgttataggtccatttttcgatggcagcattcgatggctggttgtgctcatttctatg
gctgtgtgcataattgctatgatcgtcttctccagctgcttttgttacaaacattattgc
aagagcatttcaagcagacgtcgttacaatcgtgatttggaacaggatgaagcatttatt
ccagttggagaatcattaaaagaccttattgaccagtcacaaagttctggtagtggatct
ggactacctttgttggttcagcgaactattgccaaacagattcagatggttcggcaagtt
ggtaaaggccgatatggagaagtgtggatgggtaaatggcgtggtgaaaaagtggcggtc
aaagtgtttttcaccactgaagaagcaagctggtttcgagaaacagaaatctatcaaact
gtgctaatgcgtcatgaaaacatacttggttttatagcagcagacattaaagggacaggt
tcctggactcagctctatttgattactgattaccatgaaaacggatctctctatgatttc
ctgaaatgcgctacactagacaccagagccctgctcaagttggcttactcagctgcctgt
ggtctgtgccatctccacacagaaatttatggcacccaaggaaagcctgcaattgcacat
agagatctaaagagcaaaaacatcctcatcaagaaaaatggaagttgctgtattgctgat
ctaggccttgctgttaaattcaacagtgatacaaatgaagttgatgtacccttgaatacc
cgggtgggtaccaaacgctatatggctccagaagtgctagatgaaagcctgaacaaaaac
catttccagccctacataatggctgacatctatagctttggcctgatcatttgggaaatg
gctcgtcgttgtatcacaggagggatagtagaggagtaccagttgccatattacaacatg
gtacccaacgatccatcatacgaagatatgcgtgaggtcgtgtgtgtcaaacgtttgcgg
ccagttgtgtctaatcgatggaacagtgatgaatgtctacgagcagttttgaagctaatg
tcagaatgctgggcccacaatccagcctccagacttacagctctgagaatcaagaagaca
cttgccaagatggttgaatcccaagatgtaaaaatttga

DBGET integrated database retrieval system