KEGG   Mycobacterium kansasii ATCC 12478: MKAN_20875Help
Entry
MKAN_20875        CDS       T02887                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mkn  Mycobacterium kansasii ATCC 12478
Pathway
mkn00564  Glycerophospholipid metabolism
mkn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mkn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MKAN_20875
Enzymes [BR:mkn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MKAN_20875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 GIDA NAD_binding_8 3HCDH_N HI0933_like Pyr_redox Thi4 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AGZ52484
UniProt: U5WTJ9
LinkDB All DBs
Position
4574590..4576341
Genome map
AA seq 583 aa AA seqDB search
MSNPISAPQGEQPAGTLGPQQRALAWERLGAEQFDVVVIGGGVVGSGCALDAATRGLKVA
LVEARDLASGTSSRSSKMFHGGLRYLEQLEFGLVREALYERELSLTRLAPHLVKPLPFLF
PLTKRWWERPYIAAGIFLYDRLGGAKSVPAQKHLTRAGALRLSPGLKRSSLIGGIRYYDT
VVDDARHTMTVARTAAHYGAVVRCSTQVVALLREGDRVIGVRVRDSEDGSITEVRGHVVV
NATGVWTDEIQALSKQRGRFQVRASKGVHVVVPRDRIVSDVAMILRTEKSVMFIIPWGSH
WIIGTTDTDWNLDLAHPAATKVDIDYILGTVNGVLATPLTHADIDGVYAGLRPLLAGESE
ETSKLSREHAVAVPAAGLVAIAGGKYTTYRVMAADAIDTAVQFIPARVAPSITQKVSLLG
ADGYFALVNQVEHVGAMYGLHPYRVRHLLDRYGSLIDEVLALAADDPGLLSPIREAPGYL
RVEALYAVTAEAALHLEDILARRMRISIEYPHRGVDCAREVADIIAPVLGWTAEDIGREV
ANYKARVEAEVLSQAQPDDVSADMLRASAPEARAEILEPVPLN
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaacccaatcagcgcaccgcaaggcgagcagcccgctgggacgctgggaccgcag
cagcgcgcgttggcctgggagcggctcggtgccgagcaattcgacgtggtcgtcatcggc
ggcggcgtggtgggctccgggtgcgcgctggatgctgccacccgcggtctcaaggtggcc
ctggtcgaggcccgcgacctggcctccggcacgtcgagccgctcgtcgaagatgttccac
ggcgggttgcgttacctcgagcaactggaattcggcctggtgcgtgaggccctctacgag
cgggagctgtcgctgacgcggctggcgccacacctggtcaagccgttgccgttcttgttc
ccgctgaccaagcgctggtgggaacgcccctacatcgccgcgggcatcttcctctacgac
cggctgggcggcgccaaatcggttccggcgcaaaagcatctgacccgtgccggggcgctg
cgattgagcccggggttgaagcgcagttcgctgatcggcggtatccgctactacgacacc
gtcgtcgacgatgcccgccataccatgacggtcgcgcgcaccgcggcccattacggagcc
gtcgtgcggtgctccacccaggtggtggcgctgctgcgcgagggcgaccgggtgatcggc
gtgcgggtgcgcgactccgaggacggctcgatcaccgaggtgcgcggccacgtcgtggtc
aacgcgaccggggtctggaccgacgagatccaggcgttgtccaaacagcgcggacggttc
caggtgcgcgcgtccaagggggtacacgtggtggtgccccgggaccggattgtcagcgac
gtcgcgatgatcctgcgcaccgagaagtcggtcatgttcatcattccgtggggcagccac
tggatcatcgggaccaccgacaccgactggaacctcgacctggcccatcccgcggccacc
aaggtcgacatcgactacattctgggcaccgtcaacggggtgctggctaccccgttgacg
cacgccgacatcgacggcgtgtacgccgggctgcggccgctgctggccggggaaagcgag
gaaacctccaagctgtcgcgcgagcacgccgtcgcagtgccggcggcggggctggtggcc
atcgccggcggcaagtacaccacctaccgggtgatggccgccgacgcgatcgacaccgcc
gtgcagttcattccggcccgggtcgcgccgtcgatcacccagaaggtgagcctgctgggg
gccgacggctacttcgctctggtcaaccaggtcgagcacgtcggcgcgatgtacggcctg
cacccctaccgggtgcggcatctgctggaccgctacgggtcgctgatcgacgaggtgctg
gcgttggcggccgacgatcccggtctgctcagcccgatcagggaggcgcccggctatctg
cgggtcgaagccctctatgccgtcaccgccgaggcggccctgcatctggaggacatcctg
gcccggcgcatgcggatctccatcgaatatccgcaccgcggcgtggactgcgcccgggaa
gtggccgacatcatcgcaccggtgctgggctggaccgccgaggatatcgggcgcgaggtc
gccaactacaaggcgcgcgttgaagccgaggtgctgtcacaggcccagccggacgacgta
tcggcggacatgttgcgagccagcgcacccgaagcccgggccgagatcctcgaaccggtg
ccactcaattga

DBGET integrated database retrieval system