KEGG   Mycobacterium kansasii ATCC 12478: MKAN_26160Help
Entry
MKAN_26160        CDS       T02887                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mkn  Mycobacterium kansasii ATCC 12478
Pathway
mkn00250  Alanine, aspartate and glutamate metabolism
mkn00280  Valine, leucine and isoleucine degradation
mkn00310  Lysine degradation
mkn00410  beta-Alanine metabolism
mkn00640  Propanoate metabolism
mkn00650  Butanoate metabolism
mkn01100  Metabolic pathways
mkn01120  Microbial metabolism in diverse environments
Module
mkn_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mkn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MKAN_26160
   00650 Butanoate metabolism
    MKAN_26160
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MKAN_26160
   00280 Valine, leucine and isoleucine degradation
    MKAN_26160
   00310 Lysine degradation
    MKAN_26160
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MKAN_26160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mkn01007]
    MKAN_26160
Enzymes [BR:mkn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MKAN_26160
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     MKAN_26160
    2.6.1.48  5-aminovalerate transaminase
     MKAN_26160
Amino acid related enzymes [BR:mkn01007]
 Aminotransferase (transaminase)
  Class III
   MKAN_26160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AGZ53399
UniProt: U5WW79
LinkDB All DBs
Position
complement(5742511..5743860)
Genome map
AA seq 449 aa AA seqDB search
MASLEQTRHLVTEIPGPASLELNKRRVAAVSSGVGVMLPVFVVRAGGGILEDADGNRLID
LGSGIAVTTIGNSHPKVVDAVREQVAEFTHTCFMVTPYEQYVAVAEQLNRITPGSGEKRS
ALFNSGAEAVENAIKIARAYTRKPAVVAFDHAYHGRTNMTMALTAKSMPYKSGFGPFAPE
IYRAPLSYPYRDGLLDKELATDGELAAARTISVIDKQVGASNLAAVIIEPIQGEGGFIVP
ADGFLPALLDWCRSNDVVFIADEVQTGFARTGAMFACEHEGTDGLEPDLIVTAKGIADGL
PLSAVTGRAEIMDAPHASGVGGTFGGNPVACAAALATIETIEREGLVERARQIEQQIMDR
LLRLQVADDRVGDVRGRGAMIALELVKSGTAEPDAELTEKLATAAHRAGVILLTCGMFGN
VIRLLPPLTITDELLAEGLDIMCGILGDL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtggccagcctcgagcagacacgccacctggtcaccgaaatcccgggtcccgcatcgctg
gaactgaacaaacggcgggtcgcggcggtgtccagtggtgtaggggtcatgctgccggtg
ttcgtcgtccgcgccggcggggggatcctcgaggatgccgacgggaaccggctcatcgac
ctgggttccgggatcgccgtgacgaccatcggcaattcccatcccaaggtcgtggacgcg
gtgcgcgagcaggtggcggagttcacccacacctgcttcatggtgacgccctacgagcag
tacgtggccgtcgccgaacaactcaaccggatcaccccgggctccggcgagaagcgctcg
gcgctgttcaactccggcgccgaggccgtcgagaacgccatcaagatcgcccgcgcttac
acccgcaagcccgcggtggtcgcgttcgaccacgcgtatcacggccgcaccaacatgacg
atggcgctgaccgccaagtccatgccctacaagagcggcttcggcccgttcgccccggag
atctaccgggctccgctgtcctacccctaccgcgacggactgctcgacaaggagctggcc
accgacggtgaactggccgccgcacggaccatcagcgtcatcgacaagcaggtcggcgcc
agcaacttggccgccgtcatcatcgagcccatccagggcgaaggcggtttcatcgttccc
gccgacgggttcctgcccgcgctgctggactggtgccgcagcaacgacgtcgtcttcatc
gccgacgaggtgcagaccggctttgcccgcaccggcgcgatgttcgcctgcgagcacgag
ggcaccgacggcctggagcccgacctgatcgtcaccgccaagggcatcgccgacggactg
ccgctgtccgcggtgaccggtcgggccgagatcatggatgcaccgcacgccagcggtgtg
ggcggcacgttcggcggcaacccggtcgcgtgtgcggccgcgctggccaccatcgaaacc
atcgaacgtgagggcctggtggaacgggcccggcagatcgagcagcagatcatggaccgg
ttgttgcggctgcaggtggccgacgaccgagtgggcgacgtgcgtggtcgcggcgccatg
atcgccctcgagctggtgaagtccggaaccgccgaacccgacgccgagctgaccgagaaa
ctggccaccgcagcccaccgcgccggggtgatcctgttgacttgcggcatgttcggcaac
gtcatccggctactgccgccgctgaccatcaccgacgagctactggccgaaggcctcgac
atcatgtgcgggatcctgggcgacctctga

DBGET integrated database retrieval system