KEGG   Mycobacterium leprae Br4923: MLBr00485Help
Entry
MLBr00485         CDS       T00842                                 

Gene name
gabT
Definition
(GenBank) putative 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
mlb00250  Alanine, aspartate and glutamate metabolism
mlb00280  Valine, leucine and isoleucine degradation
mlb00410  beta-Alanine metabolism
mlb00640  Propanoate metabolism
mlb00650  Butanoate metabolism
mlb01100  Metabolic pathways
mlb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mlb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MLBr00485 (gabT)
   00650 Butanoate metabolism
    MLBr00485 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MLBr00485 (gabT)
   00280 Valine, leucine and isoleucine degradation
    MLBr00485 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MLBr00485 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mlb01007]
    MLBr00485 (gabT)
Enzymes [BR:mlb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MLBr00485 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     MLBr00485 (gabT)
Amino acid related enzymes [BR:mlb01007]
 Aminotransferase (transaminase)
  Class III
   MLBr00485 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: CAR70578
UniProt: A0A0H3MPK5
LinkDB All DBs
Position
complement(588052..589392)
Genome map
AA seq 446 aa AA seqDB search
MTSVEQSRQLVTEIPGPVSLELAKRLNAAVPRGVGVTLPVFVTRAAGGVIEDVDGNRLID
LGSGIAVTTIGNSSPRVVDAVRAQVADFTHTCFIITPYEEYVAVTEQLNRITPGSGEKRS
VLFNSGAEAVENSIKVARSYTRKPAVVAFDHAYHGRTNLTMALTAKSMPYKSGFGPFAPE
IYRAPLSYPYRDGLLNKDLATDGKLAGARAINVIEKQVGADDLAAVIIEPIQGEGGFIVP
AEGFLATLLDWCRKNNVMFIADEVQTGFARTGAMFACEHDGIVPDLICTAKGIADGLPLA
AVTGRAEIMNAPHVSGLGGTFGGNPVACAAALATITTIENDGLIQRAQQIERLITDRLLR
LQDADDRIGDVRGRGAMIAVELVKSGTAEPDPELTEKVATAAHATGVIILTCGMFGNIIR
LLPPLTISDELLAEGLDILSRILGDF
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcgtcgagcagagccgtcagctggtcactgaaatccccggccccgtgtcactt
gaactagccaaacgcctcaacgcggcggtgcctcgtggggtgggagtcaccctgccagtg
tttgtaacgcgcgccgccggcggcgttatcgaggacgtcgacgggaaccggcttatcgac
ctgggttctggaatcgccgtcaccacaatcggcaactcgtcgcctcgcgttgtggacgcg
gtgcgcgcccaggtggccgactttacccacacctgtttcataatcacaccttacgaggag
tacgtcgccgtcaccgagcaactcaatcgaattaccccaggatccggcgagaaacgctcg
gtgctgttcaattccggcgccgaggcagtggagaattctatcaaggtcgcacgttcgtac
acccgcaagcccgcagtggtcgcgttcgaccacgcctaccacggtcgcaccaacctgaca
atggcactgaccgccaagtccatgccgtacaaaagcggctttggtccttttgcgccggag
atctaccgggcgccgctgtcctacccctatcgggacggcctgctcaacaaagacctagcc
accgacggcaagttggccggcgcacgggccatcaacgtcattgagaagcaggttggcgcc
gatgacctggctgccgtgatcattgagccgatccagggcgaaggcggtttcatcgtcccg
gccgaagggtttttagctactttgctggattggtgccgcaagaacaacgtgatgttcatc
gccgatgaggtgcaaacggggtttgcgcgtaccggcgccatgttcgcctgcgagcacgat
ggaatcgtgcccgacctgatctgcaccgccaagggcatcgccgacggattgccgctggcg
gcggtaaccggacgggctgagatcatgaacgccccgcacgtcagcggcctcggtggcact
ttcggcggcaacccggtcgcctgcgcggcggctttggcaaccatcacgaccatcgagaac
gacggcctgatccagcgagcccaacagatcgaacggctgatcaccgaccggttgttgcga
cttcaggacgccgacgatcggataggtgacgtacgtggccggggtgccatgatcgccgtc
gaattggtaaaatccggcacggctgagcccgaccccgagctgaccgaaaaagtagccacc
gcagcacacgctaccggcgtcatcatcttgacgtgtggcatgttcggcaacatcatccga
ctgctgccgcctctgaccataagcgacgaactgttggccgaaggccttgacatcctaagc
cggatcctgggtgacttctag

DBGET integrated database retrieval system