KEGG   Methylovirgula ligni: CWB41_02870
Entry
CWB41_02870       CDS       T05824                                 

Definition
(GenBank) histidine kinase
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
mlg  Methylovirgula ligni
Pathway
mlg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mlg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CWB41_02870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mlg01001]
    CWB41_02870
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mlg02022]
    CWB41_02870
Enzymes [BR:mlg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     CWB41_02870
Protein kinases [BR:mlg01001]
 Histidine kinases
  OmpR family
   CWB41_02870
Two-component system [BR:mlg02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   CWB41_02870
SSDB
Motif
Pfam: Stimulus_sens_1 Sensor_TM1 HATPase_c HisKA HAMP Trimer_CC
Other DBs
NCBI-ProteinID: QAY94812
LinkDB
Position
complement(606581..608410)
AA seq 609 aa
MSVEAHEQFEQVLEAPRKRNLRRSLAWRFWRRFRTLEQAVAIRFSSSLTRRIVVLNLGGL
VALLLGFLYLNQFREGLIDARVQSLQVQGEIIAAAVAASASVATDAITVDPEKLLQLIPG
KGGAPDESRPSLEFSINPERIGPVLRRLVSPTRTRARIYDRDGYLLLDSRALSARGDILR
LDLPPQNEDTGNWLDRIWAAMKRSFTYNELPLYEDIGMANGNTYPEVARALSNEAKSVVR
MNARGETIVSVAVPIELLHTVGGALLLSTQGGDIDAIIASERWAIIRVFLVSAAIMLLLS
LLLAGTIAGPMHRLAEAAERVRRGIKSRQEIPDFTNRSDEIGHLSGALRDMTRALYHRMD
AIESFAADVAHELKNPLTSLRSAVETLPIARTEDAHKRLLAIIQHDVRRLDRLISDISDA
SRLDAELARADMEPVNLARIVGTVVEIANHVEQESARVMLDIAAPGPGEDARKNGFLILG
HDSRLGQVLNNLIDNAKSFSQPGGSVRVSLRPAKAALANGTLADGFEVIVDDDGPGIPAD
AFERIFERFYTDRPNQGFGQNSGLGLSISRQIIEAHGGRIRGMNRIAAGADGAPRILGAR
FVVWIRAAR
NT seq 1830 nt   +upstreamnt  +downstreamnt
atgagcgtcgaagcgcacgagcagttcgagcaagtcctcgaagccccgcgcaagcgcaac
ctccggcgcagcctcgcgtggcggttctggcggcgtttccgcacgcttgagcaggcggtc
gcgatccgcttctcgtcctcgctcacccgccgcatcgtcgtgctcaacctcggcggcctc
gtcgcgctgctgctcggcttcctctatctcaaccagttccgcgaaggtctcatcgacgcg
cgggtgcagagcctgcaggtgcagggcgagatcatcgccgcggctgtcgccgcttcggca
agcgtcgcgacggacgcaatcaccgtcgatccggaaaagctgctgcaactcatccccggt
aaaggtggcgcgcccgacgagagccgcccctcgctcgaattttccataaatccggagcgt
atcggtccggtgctgcgccggctcgtgtcgccgacccgcacccgcgcccgcatctacgac
cgtgacggctatctgctgctcgattcacgcgcgctcagcgcgcgcggcgacattctgcgt
ctcgatctgccgccgcagaacgaggataccggcaactggctggaccggatctgggcggcg
atgaagcgctccttcacctataacgagctgccgctctacgaagatatcggcatggccaac
ggcaatacctatccggaagttgcccgtgcgctctccaacgaggccaaatccgtcgtgcgg
atgaacgccaggggcgagacgatcgtctccgtcgccgtgccgatcgaacttctgcacacc
gtgggcggcgcgcttctgctctcgacgcaaggcggcgatatcgacgcgatcatcgcctcc
gagcgctgggcgattatccgcgtcttcctggtttcggcggcgatcatgctgctgctgtcg
ctgctgcttgcgggcacgatcgccgggccgatgcaccggctggcggaagccgccgagcgg
gtgcggcgcggcatcaaatcgcgccaggagattcccgatttcaccaaccgcagcgacgag
atcggccatctctccggcgcgctgcgcgacatgacgcgggcgctctatcatcgcatggac
gccatcgagagcttcgccgccgatgtggcgcacgaattgaaaaatccgctcacttccctg
cgcagcgctgtcgagactctgccgatcgcccgcacggaggacgcacacaagcgccttctc
gccatcatccagcacgacgtgcgccggctcgaccggctgatcagcgatatttccgatgct
tcgcgcctcgatgccgaactcgcccgtgccgacatggagccggtcaatctggcgcgtatc
gtcggcacggtcgtcgagatcgccaaccatgtcgagcaggagagcgcgcgcgtcatgctc
gatattgccgcgcccggccccggcgaggacgcacgcaagaacggctttttgattctcggt
cacgactcgcgtctgggtcaagttctcaacaacctgatcgacaacgccaaatccttttcc
cagccgggcggcagcgtccgcgtcagcctgcgtccggccaaagcggcgctcgccaacggc
acgctggccgatggcttcgaggttatcgtcgatgacgatgggccgggcattcccgccgac
gccttcgagcgcattttcgagcgcttctacaccgaccggccgaatcagggcttcggtcag
aattcgggcctcggcctctccatctcgcgccagattatcgaggcgcacggcggccgtatc
cgggggatgaaccgtatcgccgcgggtgcagacggcgcgccgcggattctgggcgcgcgc
tttgttgtctggatacgggcggcgcggtga

DBGET integrated database retrieval system