KEGG   Mycobacterium liflandii: MULP_03032Help
Entry
MULP_03032        CDS       T02444                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase GabT
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mli  Mycobacterium liflandii
Pathway
mli00250  Alanine, aspartate and glutamate metabolism
mli00280  Valine, leucine and isoleucine degradation
mli00310  Lysine degradation
mli00410  beta-Alanine metabolism
mli00640  Propanoate metabolism
mli00650  Butanoate metabolism
mli01100  Metabolic pathways
mli01120  Microbial metabolism in diverse environments
Module
mli_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MULP_03032 (gabT)
   00650 Butanoate metabolism
    MULP_03032 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MULP_03032 (gabT)
   00280 Valine, leucine and isoleucine degradation
    MULP_03032 (gabT)
   00310 Lysine degradation
    MULP_03032 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MULP_03032 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mli01007]
    MULP_03032 (gabT)
Enzymes [BR:mli01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MULP_03032 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     MULP_03032 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     MULP_03032 (gabT)
Amino acid related enzymes [BR:mli01007]
 Aminotransferase (transaminase)
  Class III
   MULP_03032 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AGC62767
UniProt: L7V9C4
LinkDB All DBs
Position
3255719..3257059
Genome map
AA seq 446 aa AA seqDB search
MASLDQSRLLVTEIPGPASLELNKRRAAAVSGGVGVTLPVFVVRAGGGIVEDADGNRLID
LGSGIAVTTIGNSAPRVVDAVRDQVEQFTHTCFMVTPYEHYVAVAEQLNRITPGSGEKRT
VLFNSGAEAVENSIKVARAHTRKQAVVAFDYAYHGRTNLTMALTAKSMPYKSGFGPFAPE
IYRAPVSYPYRDNLLDKDIATDGELAAEHAINLIDKQIGAANLAAVIIEPIAGEGGFIVP
ADGFLPALQRWCRDNDVVFIADEVQTGFARTGAMFACDHENVEPDLIVTAKGIADGFPLS
AVTGRAEIMDAPHTSGLGGTFGGNPVACAAALATIETIERDGMVERARQIERLVMDRLLR
LQAADDRLGDVRGRGAMIAMELVKSGTAEPDAALTQKLAAAAHAAGVIVLTCGMFGNVIR
LLPPLTISDELLSEGLDTLCQILADL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtggccagcctcgatcaaagtcgtctcttggtcaccgaaatccccggccccgcgtcgttg
gagctcaacaagcgccgggccgcggcggtgtcgggtggcgtcggggtcaccctgccggtg
ttcgtggttcgcgcgggtggcggaatcgtggaggacgccgacggcaaccggctgatcgac
ctcggctccggcatcgccgtcacgactatcggcaattcggcgccccgcgtggtggacgcg
gtacgggaccaggtggagcagttcacccacacctgcttcatggtgaccccctacgagcat
tacgtggccgtcgccgaacagctcaatcggatcaccccgggctccggcgagaagcggacg
gtgctgttcaactccggcgccgaggcggtggagaactccatcaaggtcgcccgcgcgcac
acccgtaagcaggccgtggtcgcgttcgactacgcctaccacggccgcaccaacctgacg
atggcgctgaccgccaagtccatgccgtacaagagcggcttcggcccctttgcgccggag
atctaccgcgcaccggtgtcctacccctaccgggacaacctgctcgacaaagacatcgcc
accgacggtgagcttgccgccgaacacgccatcaacctcatcgacaagcagatcggcgcc
gccaacctggccgcggtcatcatcgaaccgatcgcgggcgagggcggcttcatcgttccg
gccgacggtttcctgcccgcgctgcagcggtggtgccgcgacaacgacgtggtgttcatc
gccgacgaggtgcagaccggatttgcccgcaccggcgccatgttcgcgtgcgaccacgag
aacgtcgagcccgacctgatcgtcaccgccaaaggcatcgccgacggattccccttgtcg
gcggtcaccggccgggccgagatcatggacgccccgcacaccagcggcttgggcggcacc
ttcggcggcaacccggtcgcgtgtgcggcggccctggccaccatcgaaacgatcgaacgc
gacggcatggtcgaacgggcccgccagatcgaacgactggtgatggaccgattgctgcgc
ctgcaagccgccgatgaccgtctcggcgatgtgcgcggccgcggcgccatgatcgccatg
gagctggtgaaatcgggcactgccgaacccgacgctgcgctcacccaaaagctggccgcc
gccgcccatgctgccggcgtaattgtcttgacgtgcggaatgttcggcaacgtgatccgg
ctgctgccaccactgacgatcagcgacgagctgctgtccgaaggcctcgacaccctgtgc
cagatcctggccgacctctag

DBGET integrated database retrieval system