KEGG   Melampsora larici-populina: MELLADRAFT_124623Help
Entry
MELLADRAFT_124623 CDS       T03138                                 

Gene name
Cla4
Definition
(RefSeq) p21-activated serine/threonine protein kinase
  KO
K19833  serine/threonine-protein kinase CLA4 [EC:2.7.11.1]
Organism
mlr  Melampsora larici-populina
Pathway
mlr04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    MELLADRAFT_124623 (Cla4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mlr01001]
    MELLADRAFT_124623 (Cla4)
Enzymes [BR:mlr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MELLADRAFT_124623 (Cla4)
Protein kinases [BR:mlr01001]
 Serine/threonine kinases: STE group
  STE20 family
   MELLADRAFT_124623 (Cla4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD PH Kinase-like Haspin_kinase Pkinase_fungal PH_11 APH
Motif
Other DBs
NCBI-GeneID: 18926865
NCBI-ProteinID: XP_007415032
JGI: Mellp1_124623
UniProt: F4S110
LinkDB All DBs
Position
Unknown
AA seq 784 aa AA seqDB search
MSNFSSLTPSRPAPPAPSEQQQALQQPSQHSSTDHHPNSHHSSRYNSGSSTSSPGLPSGY
VPAPGFTNPASSMIGSSPFPINPPANQTTIVRRGFAKLKEDGLRSWIWSQRWLILREQTL
TFHKNETTSTAAALIFLKEITNVARTDLRPYCLEVETKEKTYNLALKNDEELYGWMDDIY
SRSPLMGVSNPTNFVHQVHVGFDAVSGAFTGLPEQWTRLLTSSAITKEDYAKNPQAVLDV
LEFYTDIQKRENDEYGLGTPNMGMTDRVGGASGSNGAGAGYDSPAQHEIDYHTSPSLNSS
HNSARFNASSTRLSNQPSNQQMRNELLANPRTLASPSPSRGPETINDGPNLVPQRAAPSA
PSSASKPQAGGLKPLSLSSSASARPTQAEKPVSKPSLPVKLQQGPKPLQLGQPRTNGNTP
TLPNKSTPTPSATNPSTTNGSQTNHSENASPDLSNPSQATQTPAQAPVVKALQTVKKQEA
KSNERRISSLTEAQIMTKLRGVVSPQDPNQLYAKIKKVGQGASGSVYVAKVLATGQKVAI
KQMDLKVQPRKELIVNEILVMKESQHPNIVNFLDSFILGNDELWVVMEFMEGGALTDVID
NNSMEEDQIASICHESCKGLQHLHQQSIIHRDIKSDNVLLDCQGHVKITDFGFCAKLTDQ
KSKRATMVGTPYWMAPEVVKQKEYGAKVDIWSLGIMAIEMIENEPPYLDEEPLKALYLIA
TNGTPTLKKPERLSKELKNFLAVCLCVDVKSRATADELLQHEFLKKSCTMAGLAPLLKFK
ASSR
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacttctcatctcttactccttctcgtccggctcctccggctccttccgaacaa
caacaagcacttcaacaaccatcacaacactcatcaaccgatcatcatcccaactctcat
cattcatctcgttacaattcaggatcttctacttcttctcctggtttaccttcaggttac
gtacctgctcctggttttactaatccggctagcagtatgattggttcttctccttttcct
atcaatcctcctgcaaatcaaactacaatcgttagaagaggctttgctaaattgaaggaa
gatggtcttagaagttggatttggtctcaacgttggcttattctgcgtgaacaaacttta
acgtttcataagaatgagactacttcaactgctgctgcactcatctttctgaaagaaatc
accaatgtagctcgaaccgatttacgtccttattgtctagaagtcgaaaccaaagaaaaa
acctataacctagctcttaagaatgatgaagaactctatggatggatggatgatatttat
tctcgttcgcctttgatgggagtttcgaatccgacgaatttcgttcatcaagttcatgta
ggctttgatgcggtttcaggagcgtttacaggtttacctgaacaatggactagactgttg
accagttcggcgatcactaaagaagattatgccaagaatcctcaggctgtactcgatgta
cttgagttttatactgatattcagaaacgagaaaatgatgagtatggtcttggtactcct
aatatgggaatgactgatcgagtgggtggtgctagtggttcgaatggtgcgggtgctggt
tatgattcacctgctcaacatgagatcgattatcatacatcaccttctttgaacagtagt
cataacagtgctcgttttaatgcttcttccactagacttagcaatcaacctagtaatcaa
caaatgcgaaatgaactactagccaaccctcgtacgcttgcttcgccttctccttcacgt
ggtcctgagaccatcaatgatggaccgaaccttgtacctcaacgtgctgcacctagtgca
ccatcatctgcctctaaacctcaagcaggtggattgaaacctcttagcttatcatcttct
gcttctgcaagacccactcaagctgagaaacctgtctcgaaacctagtttgcctgtcaaa
ttacaacaaggaccaaaaccacttcaacttggacaacctagaacgaacggtaatacacca
acgttaccaaacaaatctactccgactccttcagctactaacccttctacaactaatggg
tctcaaactaatcattcagagaacgctagtccagacttatcgaatccttcacaagccaca
caaacaccagcccaagcaccggtagtgaaagccttacaaacagttaaaaaacaagaagcc
aaatcaaacgaacgtaggatctcatctttaacagaagcccaaatcatgacgaaattaaga
ggagtggtctcaccccaagacccaaatcaattatatgccaagatcaaaaaagtaggacaa
ggagcatcaggtagtgtatatgtagctaaagttttggctactggacagaaagtggcgatt
aaacagatggatttaaaggttcaacctaggaaagaattgattgtgaatgagattctggtt
atgaaagaatcacaacatccgaatattgtgaatttcttggattcctttattttagggaat
gatgaactttgggttgttatggagtttatggaaggtggggctttgactgatgtgattgat
aataatagtatggaagaagatcagatcgctagtatttgtcatgagtcttgtaaaggtctt
caacatcttcatcaacagagtattattcatcgagatattaaatcagataatgtactttta
gattgtcaaggacatgtgaagatcactgattttggattctgtgcaaaactaaccgatcaa
aaatcaaaacgagccaccatggtaggtacaccttattggatggcaccagaagtcgttaaa
caaaaggagtatggagccaaagtggatatctggtcacttggaatcatggctattgagatg
attgagaatgaaccaccttatttggatgaagaacctttgaaggcactttatttgattgct
actaatggtacacctacgttgaagaaaccggaaaggttgagtaaagaattgaaaaacttt
ttggcggtttgtttatgtgttgatgtgaaatctagagcgacggcagatgaacttttacaa
catgagtttttgaaaaagtcttgtactatggctggattggctcctttattaaagtttaaa
gcttcatcaagatga

DBGET integrated database retrieval system