Methanosarcina lacustris: MSLAZ_2261 Help Entry MSLAZ_2261        CDS       T03822                                  Name (GenBank) SSU ribosomal protein S27Ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mls  Methanosarcina lacustris Pathway mls03010   Ribosome Brite KEGG Orthology (KO) [BR:mls00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MSLAZ_2261  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mls03011]     MSLAZ_2261    04121 Ubiquitin system [BR:mls04121]     MSLAZ_2261   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mls04147]     MSLAZ_2261 Ribosome [BR:mls03011]  Ribosomal proteins   Eukaryotes    Small subunit     MSLAZ_2261   Archaea     MSLAZ_2261 Ubiquitin system [BR:mls04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MSLAZ_2261 Exosome [BR:mls04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MSLAZ_2261   Exosomal proteins of colorectal cancer cells    MSLAZ_2261 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Nudix_N_2 Ribosomal_L37e zf-NADH-PPase GFA RNA_POL_M_15KD Zn_Tnp_IS1595 DUF6671 MqsA_antitoxin DUF1451 NOB1_Zn_bind zinc_ribbon_13 Motif Other DBs NCBI-ProteinID:  AKB75522 UniProt:  A0A0E3S7U7 LinkDB All DBs Position complement(2947204..2947353) Genome browser AA seq 49 aa AA seqDB search MAVKDYYKVQGDSVTRLRQFCPRCGPGVFLAEHKTRLACGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcagttaaagattattacaaagtccagggcgactccgtaaccagactcagacagttt tgtcccagatgcggacccggtgtattccttgccgaacacaaaacccgcctcgcttgcgga aagtgcggctataccgaattcaagaaataa

DBGET integrated database retrieval system