KEGG   Methanosarcina lacustris: MSLAZ_3208
Entry
MSLAZ_3208        CDS       T03822                                 

Definition
(GenBank) Proline reductase for pyrrolysine biosynthesis
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mls  Methanosarcina lacustris
Pathway
mls00300  Lysine biosynthesis
mls01100  Metabolic pathways
mls01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mls00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MSLAZ_3208
Enzymes [BR:mls01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MSLAZ_3208
SSDB
Motif
Pfam: NAD_binding_2
Other DBs
NCBI-ProteinID: AKB76469
UniProt: A0A0E3S5N5
LinkDB
Position
complement(4121006..4121785)
AA seq 259 aa
MALLTPEDLKNINRQLQEADSAVRRVTGLDIKGVCKDFYGTTSCGEKIGIVPVTSGNGII
GNFSASLHAITEYFGFDSFVTNMPDVSGYYEAVRNGAQIILMADDNTFLAHNLKNGKIAN
NQPCTGIIYAEIASRYLKADSKDVLAVGLGKVGFPGVAHFVHKGFRVYGYDADRALLEKT
VFSLGITPFDPENPRKFSIIFEATPCADTIPEAALSENCVISTPGIPCAISRELQEKYGV
ELVMEPLGIGTASMLYSVL
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcacttttaaccccagaagacctgaaaaatattaacagacagctccaggaagctgat
tctgctgtccggagagttacagggcttgacataaaaggagtctgcaaagacttttacggt
acaacctcatgcggggaaaagataggcattgtacctgtgacctcgggaaacgggatcata
ggaaatttctcggcttctttgcacgcaattaccgagtatttcggatttgacagttttgtt
acgaatatgcctgacgtgagcggctactatgaggcagtgaggaacggggcgcaaattatc
cttatggcagatgacaataccttccttgcccacaacctcaaaaacggaaaaatagccaac
aaccagccctgtacaggcataatttatgcggagatagcttccagatacctgaaagccgat
tcaaaggatgtgcttgccgttggcctgggaaaggtgggctttccgggagtagcgcacttc
gtacataaaggcttcagggtctacggatacgatgctgacagagcactccttgaaaaaacc
gttttcagtcttgggattactcctttcgaccccgaaaaccccagaaaattctccattatt
ttcgaggcaacgccctgtgcggacacaatccccgaagcggcactttccgaaaactgcgta
atttctaccccggggattccctgcgcaatttccagggaacttcaagagaaatacggagtt
gaacttgtaatggaacctctagggatagggacggcatccatgctgtattcggtcctgtaa

DBGET integrated database retrieval system