KEGG   Mycobacterium marseillense: CKJ54_15405Help
Entry
CKJ54_15405       CDS       T05049                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mmal  Mycobacterium marseillense
Pathway
mmal00250  Alanine, aspartate and glutamate metabolism
mmal00280  Valine, leucine and isoleucine degradation
mmal00410  beta-Alanine metabolism
mmal00640  Propanoate metabolism
mmal00650  Butanoate metabolism
mmal01100  Metabolic pathways
mmal01120  Microbial metabolism in diverse environments
Module
mmal_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mmal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CKJ54_15405 (gabT)
   00650 Butanoate metabolism
    CKJ54_15405 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CKJ54_15405 (gabT)
   00280 Valine, leucine and isoleucine degradation
    CKJ54_15405 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CKJ54_15405 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmal01007]
    CKJ54_15405 (gabT)
Enzymes [BR:mmal01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CKJ54_15405 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CKJ54_15405 (gabT)
Amino acid related enzymes [BR:mmal01007]
 Aminotransferase (transaminase)
  Class III
   CKJ54_15405 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ASW93067
UniProt: A0A249BF84
LinkDB All DBs
Position
3377188..3378528
Genome map
AA seq 446 aa AA seqDB search
MASLEQTRQLVTEIPGPVSLELSKRRAAAVSHSVNVSVPVFVARAGGGIIEDVDGNRLID
LGSGIAVTTIGNSAPRVVEAVRAQVAEFTHTCFMVTPYESYVAVAETLNRITPGSGEKRS
VLFNSGAEAVENAVKVARAYTRKSAVVAFNHAYHGRTNLTMALTAKSMPYKAGFGPFAPE
VYRAPLSYPYRDGLIDKELATDGEKAAARAIRVIDSQIGADNLAALLIEPIQGEGGFIVP
AEGFLPTLLDWCRRNDVVFIADEVQTGFARSGAMFACEHEGIEPDLICTAKAIADGLPLS
AVTGRANIMDAPHVGGLGGTFGGNPLACAAALATIETIESDGLIERAQRLERLITEPLLR
LQAGDDRIGDVRGRGAMIAIELVKSGTAEPDKELTQRLTVAAQAAGVIVLTCGMFGNIIR
LLPPLTIGDELLAEGIDILSGLLRDL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtggccagcctcgagcagactcgccaactggtcaccgagatccccggcccggtctcgctg
gagctgagcaaacgccgggcggcggcggtgtcgcactcggtcaacgtctccgtcccggtc
ttcgtggcccgcgccggcggcggcatcatcgaggacgtcgacggcaaccgcctcatcgac
ctcggctccggcatcgcggtgacgaccatcggcaactcggcgccccgggtggtcgaggcg
gtgcgcgcgcaggtcgccgagttcacccacacgtgcttcatggtgacgccgtacgagtcg
tatgtcgccgtcgccgaaaccctcaatcggatcaccccgggctccggcgagaagcgctcg
gtgctgttcaattccggcgccgaggccgtcgagaacgccgtcaaggtcgcgcgcgcctac
acgcgcaagtccgccgtggtggcgttcaaccacgcctaccacggccgcaccaacctgacg
atggcgctgaccgcgaaatccatgccctacaaggccggcttcggccctttcgcgcccgag
gtctaccgggcgccgctgtcctacccctatcgggacggcctgatcgacaaggaactggcc
accgacggggaaaaggccgccgcgcgggccatccgggtcatcgacagccagatcggcgcc
gacaacctcgccgccctcctcatcgaaccgatccagggcgaaggcgggttcatcgtcccg
gccgagggattcctgcccaccctgctggactggtgccgcagaaacgacgtggtgttcatc
gccgacgaggtgcaaaccgggttcgcgcggtcgggcgccatgttcgcctgcgaacacgag
ggcatcgagcccgacttgatctgcaccgccaaagccatcgccgacgggctgcccctgtcg
gcggtcaccggccgggccaacatcatggacgcgccgcacgtcggcggcctgggcggcacc
ttcggcggaaaccccctggcctgcgcggcggcgctggccacgatcgagacgatcgagagc
gacggcttgatcgaacgggcccagcggctggaacggctgatcaccgaaccgctgctgcgg
ctgcaggccggcgacgaccggatcggtgacgtccgcggccggggcgccatgatcgcgatc
gaattggtgaagtcggggaccgccgagcccgacaaggagctgacccagcggctcactgtc
gccgcccaggcggccggcgtcatcgtcctgacctgcggcatgttcggcaacatcatccgg
ctgctgcccccgctgacgatcggcgacgaactgctggccgagggaatcgacatcctgagc
gggttgttgcgcgacctgtaa

DBGET integrated database retrieval system