KEGG   Modestobacter marinus: MODMU_5334Help
Entry
MODMU_5334        CDS       T02167                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K17758  ADP-dependent NAD(P)H-hydrate dehydratase [EC:4.2.1.136]
Organism
mmar  Modestobacter marinus
Brite
KEGG Orthology (KO) [BR:mmar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MODMU_5334
Enzymes [BR:mmar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.136  ADP-dependent NAD(P)H-hydrate dehydratase
     MODMU_5334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carb_kinase HK
Motif
Other DBs
NCBI-ProteinID: CCH90708
UniProt: I4F4Z5
LinkDB All DBs
Position
complement(5315213..5316103)
Genome map
AA seq 296 aa AA seqDB search
MSRPQPDATLVTPQVLRGWRLPEPTGGKESRGSILVVGGSTETLGAVTLAAEAALRSGAG
KLQVVVPSKVAPHVSIALPEALVRGVPSTEAGAIEGSSVELFLDLVQKASAVLVGPGMAD
REQTQALVEALLPELKSPVVLDALGLAAVTADPGCLHHLGGRVVLTPNPTELAISLHVDA
DEVEDDPAGCARRLAEQAHATVGLGGATSWVAGPDGRLWEDESGGAGLGVSGSGDVRAGV
VAGLLARGAEPDQAAVWASYLHGRAGERLAATVGRLGFLARELPPEVPRVLAEVDL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtccccagcctgatgccaccctggtcaccccgcaggtgctgcgcggctggcgg
ttgcccgagccgaccgggggcaaggagtcccgcggctcgatcctggtggtcggcggcagc
accgagaccctcggcgcggtgaccctggcggccgaggcggcgctgcgctccggcgcgggc
aagctgcaggtcgtcgtcccgtcgaaggtcgccccgcacgtgtccatcgcgctgccggag
gcgctggtccgcggcgtgccgtcgaccgaggccggcgccatcgagggctcgtcggtcgag
ctgttcctggacctggtgcagaaggcgtccgcggtgctcgtcggcccggggatggccgac
cgggagcagacgcaggccctggtggaggcgctgctgccggagctgaagtccccggtggtg
ctggacgcgctcgggctggccgcggtcaccgccgacccgggctgcctgcaccacctggga
ggccgggtggtgctgacgcccaacccgaccgagctggcgatctcgctgcacgtcgacgcc
gacgaggtcgaggacgacccggccggctgcgcgcgccggctggccgagcaggcgcacgcg
accgtgggcctgggcggcgcgaccagctgggtggccgggccggacgggcggctgtgggag
gacgagagcggcggtgcggggctcggcgtctccggctccggtgacgtgcgggccggggtg
gtcgcggggctgctggcccgcggggccgagccggaccaggccgcggtgtgggcctcctac
ctgcacggccgggcgggcgagcggctggccgcgacggtcggccggctcggcttcctggcc
cgcgagctgccccccgaggtcccccgggtgctcgccgaggtggacctctga

DBGET integrated database retrieval system