KEGG   Myxococcus macrosporus: MYMAC_005276
Entry
MYMAC_005276      CDS       T05096                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11208  GST-like protein
Organism
mmas  Myxococcus macrosporus
Brite
KEGG Orthology (KO) [BR:mmas00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    MYMAC_005276
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N
Other DBs
NCBI-ProteinID: ATB49622
UniProt: A0A250K1N3
LinkDB
Position
6643813..6644439
AA seq 208 aa
MDDYELIGSPGCGSAIVEMALRISGIPYRLTDLPYLEPGPGRDRLLKLNPLGQVPTLVLP
GGAVMTESAAILLHLHDVAPQGALVPEATAPERTRFLNLLFRLVGAVYPTFTYADDPPKW
TLAGPAADRLRDTVMERRATLWREIEAQVGRPHVLGERFSALDLYVTMMTHWRPGKDWFA
QHCPALTAAASQAEKNPHVAAVLERHFR
NT seq 627 nt   +upstreamnt  +downstreamnt
atggacgactacgagttgattggctcacccgggtgtggctcggccatcgtggagatggcg
ctgcgcatcagcggcatcccctaccggctgacggacctgccctacctggagccgggtccc
gggcgcgaccggctgttgaagctcaacccgctgggacaggtgcccaccctggtcctcccc
ggtggcgcggtgatgacggagagcgcggccatcctcctgcacctgcacgacgtcgcgccc
cagggcgccctggtgccggaggccaccgcgcccgagaggacgcgcttcctcaacctgctg
ttccgcctggtgggcgccgtgtacccgaccttcacgtacgcggatgacccgcccaagtgg
accctggccggccccgccgcggaccggctgcgcgacaccgtcatggagcgccgcgccacc
ctttggcgtgaaatcgaggcccaggtgggcaggccccacgtgctcggcgagcgcttcagc
gcgctggacctctacgtcaccatgatgacgcactggcgacctgggaaggactggttcgcc
cagcactgccccgccctgacggcggcggcatcccaggccgagaagaacccgcacgtcgcc
gcggtgctggagcgtcacttccgctga

DBGET integrated database retrieval system