KEGG   Myxococcus macrosporus: MYMAC_005773
Entry
MYMAC_005773      CDS       T05096                                 

Definition
(GenBank) histidine kinase
  KO
K07636  two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC:2.7.13.3]
Organism
mmas  Myxococcus macrosporus
Pathway
mmas02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mmas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MYMAC_005773
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmas01001]
    MYMAC_005773
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mmas02022]
    MYMAC_005773
Enzymes [BR:mmas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     MYMAC_005773
Protein kinases [BR:mmas01001]
 Histidine kinases
  OmpR family
   MYMAC_005773
Two-component system [BR:mmas02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   MYMAC_005773
SSDB
Motif
Pfam: HATPase_c HisKA GAF_3 GAF_2
Other DBs
NCBI-ProteinID: ATB50118
UniProt: A0A250K2C3
LinkDB
Position
complement(7219749..7221068)
AA seq 439 aa
MKEPRRPAGNGPAFRRRPRRAWHKRGHGRRHQARLHELGQLLCGADTLASSFSALVERLT
RWLPVRAALLLEGVDAAGQPALERPCLSAWHPAGDGASTLSRAVAHAAAAYAYLVGLEQV
ALQGRDAPAGVFAAEPAVAPGAITLPLVAKEGILGALHVEAVGLQEEGLSLLDAVANLLA
VALAREHVLRREVWLRERAEALFLQAQEAVRWRDELLTVVSHDIKTPLLAVRMNAEMILK
TGTAPEKESRRRRYLENIVLAEQQMSSLIGNLLDRARLRGMPIPLALQPHPVEDLLAQSL
EVLRPLALEKEQRLTVALAPRTPPVRADRERVLQVLANLVSNAIKFTPPGGTIVLSARPE
EAGAWVRIAVKDSGPGIPAEDAPHLFERFWRASHSPGRGTGLGLSIAWNLVAAHGGTLNV
ESQEGQGSTFFFTLPVASP
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgaaggagccacggcgccccgcggggaacggccccgcctttcgcaggcggccgcgccgc
gcgtggcacaagcgcgggcacggccgccgccaccaggcgcggctccatgagcttggccag
ttgctctgtggcgcggacaccctcgcgtccagcttctccgccctggtggagcgcctgacg
cgctggctcccggtgcgcgccgcgctgctgctggagggcgtggacgcggccgggcagccc
gccctggagcggccctgcctgtcggcgtggcatcccgccggggacggggcgtccacgctg
tcccgggccgtggcccatgccgccgcggcgtacgcctacctcgtgggactggagcaggtg
gcgctccagggccgtgatgcccccgcgggcgtgttcgcggcggagcccgccgtggcgccg
ggggccatcaccctgccgttggtggcgaaggagggcatcctgggcgcgctccacgtggag
gcggtggggctccaggaagaggggctgtccctcctggacgcggtggcgaacctgctggcg
gtggccctggccagggagcacgtcctgcgccgcgaggtgtggctgcgcgagcgcgccgag
gcgctgttcctccaggcccaggaggcggtgcgctggcgcgacgagctgctcaccgtcgtc
tcccatgacatcaagacgccgctgctcgcggtgcggatgaacgcggagatgattctgaag
acgggcacggcgccggagaaggagtcccgccgccgccgctacctggagaacatcgtcctc
gccgagcagcagatgagcagcctcatcggcaacctgctggaccgggcgcgcctgcgcgga
atgcccatccccttggcgctccagccccacccggtggaggacctgctggcgcagtcgctg
gaggtgctgcggccgctcgccctggagaaggagcagcggctcacggtggcgctggcgccc
cggacgccgccggtgcgcgccgaccgggagcgcgtcctccaggtgctggccaacctggtg
agcaacgccatcaagttcacgcccccgggcggcaccatcgtcttgagcgcccgcccggag
gaagcgggggcgtgggtgcgcatcgccgtgaaggactctggcccgggcatccccgccgag
gacgcgccgcacctcttcgagcgcttctggcgggccagccactcaccggggcgcggcacg
gggctggggctgagcatcgcctggaacctggtggccgctcacggcgggacgctcaacgtg
gagagccaggaggggcaggggagcaccttcttcttcaccctgcccgtggcctcgccctga

DBGET integrated database retrieval system