Methylotenera mobilis: Mmol_1053 Help Entry Mmol_1053         CDS       T00942                                  Name (GenBank) conserved hypothetical protein   KO K02277   cytochrome c oxidase subunit IV [EC:7.1.1.9] Organism mmb  Methylotenera mobilis Pathway mmb00190   Oxidative phosphorylation mmb01100   Metabolic pathways Module mmb_M00155   Cytochrome c oxidase, prokaryotes Brite KEGG Orthology (KO) [BR:mmb00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Mmol_1053 Enzymes [BR:mmb01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.9  cytochrome-c oxidase      Mmol_1053 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  COX4_pro Motif Other DBs NCBI-ProteinID:  ACT47962 UniProt:  C6WVL3 LinkDB All DBs Position 1150719..1150979 Genome browser AA seq 86 aa AA seqDB search MNQSNNHFSICIWLALVALTIVTYFIGEEVTAGKAIMLSVLVIALIKGQLIANYFMGLRQ VSWLWRGIILGYFVVVGVMVAIAYLM NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaatcaatctaacaaccatttttctatatgcatctggctagcgctggttgcacttacg atagtgacttactttattggcgaggaagtgactgcaggtaaggcaatcatgctgagtgtg ctggtcattgccttaatcaaaggccagttgatcgcgaattactttatggggttgcgtcag gtaagttggctttggcgcggcattattcttgggtattttgtggtggtaggcgtgatggtt gctatcgcttatttaatgtaa

DBGET integrated database retrieval system