KEGG   Methylotenera mobilis: Mmol_2227Help
Entry
Mmol_2227         CDS       T00942                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mmb  Methylotenera mobilis
Brite
KEGG Orthology (KO) [BR:mmb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mmol_2227
Enzymes [BR:mmb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Mmol_2227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored DAO FAD_binding_3 HI0933_like Thi4 Glutaredoxin AlaDh_PNT_C NAD_binding_8 K_oxygenase DUF3501 FMO-like
Motif
Other DBs
NCBI-ProteinID: ACT49129
UniProt: C6WT67
LinkDB All DBs
Position
complement(2406596..2408179)
Genome map
AA seq 527 aa AA seqDB search
MALETGIKTQLQTYLQMLREPIVLAASLDETPAAQEMRELLEEITSMSDKITLTMEDDAR
KPSFAVKRGAGHAEANKAVGVRFAGIPMGHEFTSLVLALLHTGGHPMKLEPEKIAQIAAI
EGSFHFETYISLSCHNCPDVVQAMNMMAVINPNITHVMIDGALYQDEVKAREIMSVPTIY
LNGEVFGAGRMELDEILPKIDLGAVAREAKKLDAQAPFDVLVVGGGPAGASAAIYAARKG
IRTGIVAERFGGQVMDTLGIENFISVKETEGPKLVMALEEHVKSYDVEIINLQRAVSLTE
PGKHGNKNEDLIELKLESGATLRSKSVILATGARWRELNVPGEKEYRGKGVAYCPHCDGP
LFKGKPVAVVGGGNSGVEAAIDLANFVDHVTLLQFDTELKADAVLQKKLRSLHNVTIITS
AQTTEVTGDGNKMNGLTYTDRVTGESKHLALDGVFVQIGLVPNSDWLKGTLNLSKYGEVE
VNHHNATSLPGVFAAGDVTTTPYKQIIIAMGEGAKASLGAFDYLIRQ
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcattagaaactggtatcaaaacccaattgcaaacctatttacagatgttgcgtgag
cctatcgtgttggctgcgtcattagatgaaacaccagccgcacaggaaatgcgtgagctg
ctggaggaaatcaccagcatgtcagacaaaattacgctgacgatggaggatgatgcgcgc
aaaccatcatttgctgtaaagcgtggtgcaggtcatgccgaagcaaataaagcggtcggt
gtgcgttttgctggtattcctatgggtcatgagtttacctctttagtgttggcgctattg
catacgggcggtcacccgatgaagctagagccagaaaaaattgcgcaaatcgcagcgatt
gaaggtagcttccattttgagacttatatttcactgagctgccataactgcccagacgta
gtacaagccatgaatatgatggcggtgattaaccccaacatcacccatgtgatgattgat
ggtgcgctgtatcaggatgaagttaaagcaagagaaattatgtccgtgccaaccatttac
ttaaatggtgaggtgtttggcgcaggccgtatggaactagatgaaatcctgccaaaaatc
gatcttggcgcggtggcgcgtgaggcgaaaaagctagatgcacaagcgccttttgacgtg
ttggtcgtgggcggtggccctgcgggtgcctctgcggctatctatgcggcacgtaaaggc
atacgcactggtattgttgccgagcgctttggcgggcaggtgatggacaccttaggcatt
gaaaactttatttcggtaaaggaaaccgaagggccaaaactagtaatggcgctggaagag
cacgtaaaaagctacgatgtagaaatcataaacttgcagcgtgcggtttcactcactgag
ccaggcaagcatggcaacaaaaacgaagatttaatcgagctgaaactggagagcggtgct
accttaagaagtaaatcggtgattctggctaccggtgcacgctggagagagttgaatgtg
cctggtgagaaagagtaccgtggcaaaggcgtggcttattgcccacactgtgatggtccg
ttatttaaaggcaagccagtggcagtagtcggcggtggtaactccggggtagaggcagcg
attgatttggccaactttgttgaccatgtgaccttgctgcaatttgataccgagttaaaa
gccgatgccgtgttgcagaagaaattacgttctttgcataacgtgaccatcattaccagc
gcacaaaccactgaggtgacgggcgatggtaacaagatgaatggcttgacgtataccgac
cgcgtcacaggtgagtctaagcatttggcgttggatggtgtatttgtgcagattggttta
gtgccgaatagcgattggttaaaaggtactttaaacctgagtaagtacggcgaagtagaa
gtgaatcaccataacgcaacatcgctgccaggcgtgtttgctgctggcgacgtgacaact
accccttacaagcaaatcattattgccatgggtgagggggctaaagcttcattaggtgcg
tttgattacttaattaggcaatag

DBGET integrated database retrieval system