KEGG   Mycobacterium sp. MCS: Mmcs_1372
Entry
Mmcs_1372         CDS       T00367                                 

Definition
(GenBank) 2-chlorobenzoate 1,2-dioxygenase
  KO
K05550  benzoate/toluate 1,2-dioxygenase subunit beta [EC:1.14.12.10 1.14.12.-]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00362  Benzoate degradation
mmc00364  Fluorobenzoate degradation
mmc00622  Xylene degradation
mmc01100  Metabolic pathways
mmc01120  Microbial metabolism in diverse environments
mmc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mmcs_1372
   00364 Fluorobenzoate degradation
    Mmcs_1372
   00622 Xylene degradation
    Mmcs_1372
Enzymes [BR:mmc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.10  benzoate 1,2-dioxygenase
     Mmcs_1372
    1.14.12.-  
     Mmcs_1372
SSDB
Motif
Pfam: Ring_hydroxyl_B SnoaL_4
Other DBs
NCBI-ProteinID: ABG07484
UniProt: A0A5Q5BGV2
LinkDB
Position
complement(1489632..1490153)
AA seq 173 aa
MSSQTTSAAATLITQNMIEQFLYREARYLDDREFEKWLGCYADDVVYWMPSWADDDTLVE
DPQRDISLVYYANKGGLEDRVFRIRTERSSATSLPEPRTSHNISNVEVIERRGDLVDVRF
NWHTMYFRYKTIDPYYGTSFYTIDFSGDHPLIRRKTVVLKNDYIHHVVDIYHF
NT seq 522 nt   +upstreamnt  +downstreamnt
atgtccagccaaaccacctcagccgcagccacactcatcacccagaacatgatcgagcag
ttcctctaccgggaggcccgctacctcgacgaccgcgagttcgagaagtggctgggctgc
tacgccgacgacgtcgtctactggatgccgtcgtgggccgacgacgacacgctggtggag
gatccgcagcgggacatctcgctggtctactacgcgaacaagggtggcctcgaagaccgc
gtcttccgaatccgcaccgaacgctcctcggccacgtcacttcccgaaccacgcaccagc
cacaacatcagcaacgtcgaggtcatcgaacgccgcggcgacctggtggacgtccggttc
aactggcacaccatgtatttccggtacaagacgatcgacccgtattacggcacctccttc
tacaccatcgacttctccggtgatcatccgctgatccgtcgaaagaccgtggtgctcaag
aacgactacatccaccacgtcgtggacatctaccacttctag

DBGET integrated database retrieval system