KEGG   Methylomonas methanica: Metme_0761Help
Entry
Metme_0761        CDS       T01511                                 

Definition
(GenBank) Ribosomal RNA small subunit methyltransferase E
  KO
K09761  16S rRNA (uracil1498-N3)-methyltransferase [EC:2.1.1.193]
Organism
mmt  Methylomonas methanica
Brite
KEGG Orthology (KO) [BR:mmt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmt03009]
    Metme_0761
Enzymes [BR:mmt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.193  16S rRNA (uracil1498-N3)-methyltransferase
     Metme_0761
Ribosome biogenesis [BR:mmt03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    Metme_0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltrans_RNA
Motif
Other DBs
NCBI-ProteinID: AEF99202
UniProt: G0A5S5
LinkDB All DBs
Position
812155..812883
Genome map
AA seq 242 aa AA seqDB search
MRVSRLYVNAPLNVGGRIELDEEAAHYVRSVLRLKQGEAMVLFNGQGGEYLSCFSEVSRK
TVRLEIEQFSDRDVESPLAVTLGVGISRGDRMDWAVQKAVELGVTQLTPLFTERCVTKLN
DDKKQQRLRHWQHIVQHAAEQSGRTRVPAMDEIAELSEWVCRQQGLRVFLDPYATRSLAD
CQPENNQITLLSGPEGGFSERERQIAKAAGFVPVRMGARILRTETAVLSALSAVQTLWGD
FR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgtcccgtttatatgtcaatgcaccgctcaacgtcggtggtcgtatagagctg
gacgaagaagcggcgcattatgtgcgtagcgtgttacggctcaaacaaggtgaggccatg
gtattgttcaatggccaaggtggagagtacctgagctgtttcagcgaagtcagccgcaaa
acggtgcggctggagatcgaacaattctcggatcgcgacgtggagtctccgttggcggtg
acattgggtgtggggatctcccgtggcgatcgtatggactgggcggtacaaaaggcggtg
gagttgggggtgactcaattaacgccgttgttcaccgaacgctgcgtgaccaaactcaac
gacgacaaaaagcagcagcgcctgcgccattggcaacatattgtgcagcatgccgccgaa
cagtcggggcgtacccgtgtgccggcaatggatgaaattgccgagttgtcggaatgggtt
tgcaggcagcaggggttacgggtatttttagatccttatgcgactcgaagcctggcggat
tgccagccggaaaacaaccaaatcaccctgttatccggtccggaaggcggtttcagcgag
cgtgaaaggcaaattgccaaggctgccggctttgtgccggtcaggatgggggcgcggatt
ttgcgcaccgaaaccgccgtgttgtcggcattaagcgctgtgcaaacgctatggggggac
tttcgttga

DBGET integrated database retrieval system