KEGG   Methylomonas methanica: Metme_0786Help
Entry
Metme_0786        CDS       T01511                                 

Definition
(GenBank) Integrase catalytic region
Organism
mmt  Methylomonas methanica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve rve_3 HTH_32 DDE_Tnp_IS240 HTH_23 HTH_29 HTH_28 rve_2 HTH_17 HTH_8 HTH_Tnp_1 Phage_Capsid_P3 HTH_31 BACK NOPS
Motif
Other DBs
NCBI-ProteinID: AEF99225
UniProt: G0A5U8
LinkDB All DBs
Position
complement(841090..842172)
Genome map
AA seq 360 aa AA seqDB search
MTSLQQRQTLIESVAEATEAGARQDQACAVLGLSPRTLQRWQAGETPGEDRRPRRQYTPA
HALTEAERNHILAVANSAEFADLPPSQIVPRLADQGIYLGSESTIYRLLKAAQQLKHRRS
ERPSQPRFKPKALSATEPNQLYSWDITYLAAAVKGQFYYLYLFLDIFSRQIVGWQVFEEE
SSQYASELLRDIVLREGLQPGQVILHSDNGSPMKGATMLATLQQLGVMPSLSRPAVSNDN
PYSESLFKTLKYRPQYPLQPFADLSVAREWVADLVQWYNHEHRHSAIGFVTPAQRHAGLD
EALLNQRKALYEDARRQNPRRWSQNTRNWNRIHTVHLNPDHAETQNNSPQEVANPDKITA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccttcagcagcgccaaaccctgatcgaatccgtcgccgaagccaccgaggcc
ggtgcccgccaagaccaagcctgtgccgtgctgggcctgagcccgcgcaccttgcagcgc
tggcaggccggcgaaaccccgggcgaagaccggcgaccgaggcggcaatatacgccggcg
catgcgctgaccgaggccgagcgcaaccacattctggccgtggccaattccgccgaattt
gcggatttaccccccagtcagatcgttccgcgcttggcggatcaggggatttatctgggc
tccgaatcgacgatctatcgcctactgaaagccgcccagcaactgaaacaccgccgcagt
gaacgtcccagtcagcctcgcttcaaacccaaagcattgagtgcgaccgagcccaatcaa
ctctacagctgggatattacctatcttgcggccgcagtcaaaggccagttctactacctc
tacttgttcctcgatatttttagtcgccagatcgtcggctggcaggtatttgaggaagaa
agcagccaatacgccagcgagttgttacgggatattgttttacgcgaagggctacaacct
gggcaagtcatcctgcattccgataacggcagccccatgaaaggcgccacgatgctggcc
accctgcaacagcttggcgtcatgccctcgctcagccgaccggcggtgagtaatgacaat
ccgtattcggaatcgctgttcaaaaccctgaaatatcgtccgcaatacccgttgcaaccg
tttgccgacctgtccgtcgctcgtgaatgggtagccgacctggtgcaatggtacaaccac
gaacatcggcatagcgccattggttttgtaaccccagcccaacgtcatgccggattggac
gaggcactattgaatcaacgcaaagcgctctatgaagacgcccgccgccaaaacccacgg
cgctggagccaaaacacccggaactggaacagaatccataccgtgcatctaaatccggat
catgccgaaacccaaaacaactcgccccaggaggtcgctaatccagacaaaataaccgca
tag

DBGET integrated database retrieval system