KEGG   Methylomonas methanica: Metme_0791Help
Entry
Metme_0791        CDS       T01511                                 

Definition
(GenBank) N-acetyl-gamma-glutamyl-phosphate reductase
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
mmt  Methylomonas methanica
Pathway
mmt00220  Arginine biosynthesis
mmt01100  Metabolic pathways
mmt01110  Biosynthesis of secondary metabolites
mmt01130  Biosynthesis of antibiotics
mmt01210  2-Oxocarboxylic acid metabolism
mmt01230  Biosynthesis of amino acids
Module
mmt_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mmt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Metme_0791
Enzymes [BR:mmt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     Metme_0791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AEF99230
UniProt: G0A5V3
LinkDB All DBs
Position
845281..846309
Genome map
AA seq 342 aa AA seqDB search
MIRAGIVGGTGYTGVELLRILALHSEVAVTTVTSRADAGQRVDKLYPSLRGLCDAVFSLP
EIDNLAACDVVFFATPNGTAMQMAADLLARGVKVIDLSADFRIKDVAEWEKWYGMQHASP
ELIVEAVYGLPEVNREAIKQARLIACPGCYPTAVQLGFLPLLENSVVDAQYLIADVKSGV
SGAGRKAEISSLMSEAGESFKAYAVAGHRHLPEIRQGLQLATSETVGLTFVPHLTPMIRG
IHATLYARLKQDVDLQALFEQRYQNESFADVLPVGSHADTRNVRGSNRCQIAVHQPQGSD
TVVVLSVIDNLVKGASGQAVQNMNLLFGLPEQQGLETVALYP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgatacgtgctggcattgtgggcggtaccggttataccggggtggaattattacggata
ttggcgttgcattccgaagtggcggttactacggtcacttcgcgcgccgatgccggtcag
cgcgtggataaactttaccccagcctgcgagggttgtgcgatgcggtgtttagtttgccg
gaaatcgacaatttggcggcctgcgatgtggtgttttttgctacgcccaacggtacggcg
atgcaaatggcggcggatttattggcgcgcggcgtcaaggtgatcgacttgtcggccgat
tttcgcatcaaggacgtggctgagtgggaaaaatggtacggcatgcagcatgccagtccg
gaattgattgtcgaagcggtttacggtttgccggaagttaatcgggaggcgataaaacaa
gctcgtttgatcgcctgccccgggtgttatccgaccgccgtgcagttgggatttttgcct
ttactggaaaatagtgtagtcgatgcgcagtatttgattgccgatgtaaagtccggggtc
agcggagcaggccggaaagcggagatttcatcgttgatgagcgaagccggcgagagtttt
aaggcctatgcggtggctgggcatcggcatttaccggaaattcggcaaggtttgcagttg
gcgacatctgaaacggtcggtttgacgttcgtgccgcatctgacaccgatgatacgcggg
attcacgcgacattgtatgcgcgcttgaagcaagacgtcgatctgcaggcgctattcgaa
caacgttaccaaaacgagtcgtttgcggatgtgttgccggtcggctcgcatgcggatacc
cgtaatgtgcggggcagcaatcgttgccaaattgccgtgcatcagccgcagggcagcgac
accgtggtggttttgtcggtgatcgataatctggtgaaaggcgcttcgggtcaggcggtg
caaaatatgaatctgctattcggtttgcctgagcagcaaggtctggaaacagtggcgtta
tatccctaa

DBGET integrated database retrieval system