KEGG   Mus musculus (mouse): 11606Help
Entry
11606             CDS       T01002                                 

Gene name
Agt, AI265500, AngI, AngII, Aogen, Serpina8
Definition
(RefSeq) angiotensinogen (serpin peptidase inhibitor, clade A, member 8)
  KO
K09821  angiotensinogen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04614  Renin-angiotensin system
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04931  Insulin resistance
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04934  Cushing syndrome
mmu05200  Pathways in cancer
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    11606 (Agt)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11606 (Agt)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    11606 (Agt)
   04614 Renin-angiotensin system
    11606 (Agt)
   04925 Aldosterone synthesis and secretion
    11606 (Agt)
   04927 Cortisol synthesis and secretion
    11606 (Agt)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11606 (Agt)
   04270 Vascular smooth muscle contraction
    11606 (Agt)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11606 (Agt)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    11606 (Agt)
   05414 Dilated cardiomyopathy (DCM)
    11606 (Agt)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    11606 (Agt)
   04933 AGE-RAGE signaling pathway in diabetic complications
    11606 (Agt)
   04934 Cushing syndrome
    11606 (Agt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin
Motif
Other DBs
NCBI-GeneID: 11606
NCBI-ProteinID: NP_031454
MGI: 87963
Ensembl: ENSMUSG00000031980
Vega: OTTMUSG00000061562
UniProt: Q3UTR7
LinkDB All DBs
Structure
PDB: 

Position
8 E2; 8 72.81 cM
AA seq 477 aa AA seqDB search
MTPTGAGLKATIFCILTWVSLTAGDRVYIHPFHLLYHNKSTCAQLENPSVETLPESTFEP
VPIQAKTSPVNEKTLHDQLVLAAEKLEDEDRKRAAQVAMIANFVGFRMYKMLNEAGSGAS
GAILSPPALFGTLVSFYLGSLDPTASQLQTLLDVPVKEGDCTSRLDGHKVLAALRAIQGL
LVTQGGSSSQTPLLQSIVVGLFTAPGFRLKHSFVQSLALFTPALFPRSLDLSTDPVLATE
KINRFIKAVTGWKMNLPLEGVSTDSTLLFNTYVHFQGTMRGFSQLPGVHEFWVDNSISVS
VPMISGTGNFQHWSDTQNNFSVTCVPLGERATLLLIQPHCTSDLDRVEALIFRNDLLTWI
ENPPPRAIRLTLPQLEIRGSYNLQDLLAEDKLPTLLGAEANLNNIGDTNPRVGEVLNSIL
LELKAGEEEQPTTSVQQPGSPEALDVTLSSPFLFAIYEQDSGTLHFLGRVNNPQSVV
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgactcccacgggggcaggcctgaaggccaccatcttctgcatcttgacctgggtcagc
ctgacggctggggaccgcgtatacatccaccccttccatctcctttaccacaacaagagc
acctgcgcccagctggagaaccccagtgtggagacactcccagagtcaacgttcgagcct
gtgcccattcaggccaagacctcccctgtgaatgagaagaccctgcatgatcagctcgtg
ctggccgccgagaagctagaggatgaggaccggaagcgggctgcccaggtcgcaatgatc
gccaacttcgtgggcttccgcatgtacaagatgctgaatgaggcaggaagtggggccagt
ggggccatcctctcaccaccagctctctttggcaccctggtctctttctaccttggatcc
ttagatcccacggccagccagctgcagacgctgctggatgtccctgtgaaggagggagac
tgcacctcccgactagatggacacaaggtcctcgctgccctgcgggccattcagggcttg
ctggtcacccagggtgggagcagcagccagacacccctgctacagtccattgtggtgggg
ctcttcactgctccaggctttcgtctaaagcactcatttgttcagagcctggctctcttt
acccctgccctcttcccacgctctctggatttatccactgacccagttcttgccactgag
aaaatcaacaggttcataaaggctgtgacagggtggaagatgaacttgccactggagggg
gtcagtacagacagcaccctacttttcaacacctacgttcacttccaaggaacgatgaga
ggtttctctcagctgcctggagtccatgaattctgggtggacaacagcatctcggtgtct
gtgcccatgatctccggcactggcaacttccagcactggagtgacacccagaacaacttc
tccgtgacgtgcgtgcccctaggtgagagagccaccctgctgctcatccagccccactgc
acctcagatctcgacagggtggaggccctcatcttccggaacgacctcctgacttggata
gagaacccgcctcctcgggccatccgcctgactctgccccagctggaaatccgaggatcc
tacaatctgcaggacctgctggctgaggacaagctgcccacccttttgggtgcggaggca
aatctgaacaacattggtgacaccaacccccgagtgggagaggttctcaatagcatcctc
ctcgaactcaaagcaggagaggaggaacagccgaccacgtctgtccagcagcctggctca
ccggaggcactggatgtgaccctgagcagccccttcctgttcgccatctacgagcaggac
tcaggcacgctgcactttctgggcagagtgaataacccccagagtgtggtgtga

DBGET integrated database retrieval system