KEGG   Mus musculus (mouse): 11789
Entry
11789             CDS       T01002                                 

Gene name
Apc, AI047805, AU020952, AW124434, CC1, M, Min, mAPC
Definition
(RefSeq) APC, WNT signaling pathway regulator
  KO
K02085  adenomatosis polyposis coli protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04810  Regulation of actin cytoskeleton
mmu04934  Cushing syndrome
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05213  Endometrial cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    11789 (Apc)
   04390 Hippo signaling pathway
    11789 (Apc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    11789 (Apc)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    11789 (Apc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11789 (Apc)
   05206 MicroRNAs in cancer
    11789 (Apc)
  09162 Cancer: specific types
   05210 Colorectal cancer
    11789 (Apc)
   05225 Hepatocellular carcinoma
    11789 (Apc)
   05226 Gastric cancer
    11789 (Apc)
   05217 Basal cell carcinoma
    11789 (Apc)
   05213 Endometrial cancer
    11789 (Apc)
   05224 Breast cancer
    11789 (Apc)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11789 (Apc)
   05022 Pathways of neurodegeneration - multiple diseases
    11789 (Apc)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    11789 (Apc)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    11789 (Apc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    11789 (Apc)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    11789 (Apc)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    11789 (Apc)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     11789 (Apc)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    11789 (Apc)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     11789 (Apc)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_rep APC_u14 APC_u15 APC_u9 SAMP Arm APC_u13 APC_15aa Suppressor_APC
Other DBs
NCBI-GeneID: 11789
NCBI-ProteinID: NP_001347908
MGI: 88039
Ensembl: ENSMUSG00000005871
Vega: OTTMUSG00000035932
LinkDB
Position
18 B1; 18 18.53 cM
AA seq 2783 aa
MTSGQIDLLERLKEFNLDSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPRR
TFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSLQ
TDMTRRQLEYEARQIRAAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRVRQLLQSQAAE
AERSSQSRHDAASHEAGRQHEGHGVAESNTAASSSGQSPATRVDHETASVLSSSGTHSAP
RRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLLH
GNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETCW
EWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQV
DCEMYGLTNDHYSVTLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQ
QVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTE
NKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNC
LQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAMG
SAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLSP
KASHRSKQRHKQNLYGDYAFDANRHDDSRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGSL
DSSRSEKDRSLERERGIGLSAYHPTTENAGTSSKRGLQITTTAAQIAKVMEEVSAIHTSQ
DDRSSASTTEFHCVADDRSAARRSSASHTHSNTYNFTKSENSNRTCSMPYAKVEYKRSSN
DSLNSVTSSDGYGKRGQMKPSVESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGEL
DTPINYSLKYSDEQLNSGRQSPSQNERWARPKHVIEDEIKQNEQRQARSQNTSYPVYSEN
TDDKHLKFQPHFGQQECVSPYRSRGTSGSETNRMGSSHAINQNVNQSLCQEDDYEDDKPT
NYSERYSEEEQHEEEEERPTNYSIKYNEEKHHVDQPIDYSLKYATDISSSQKPSFSFSKN
SSAQSTKPEHLSPSSENTAVPPSNAKRQNQLRPSSAQRNGQTQKGTTCKVPSINQETIQT
YCVEDTPICFSRCSSLSSLSSADDEIGCDQTTQEADSANTLQTAEVKENDVTRSAEDPAT
EVPAVSQNARAKPSRLQASGLSSESTRHNKAVEFSSGAKSPSKSGAQTPKSPPEHYVQET
PLVFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPP
PPPQTVQAKREVPKSKVPAAEKRESGPKQTAVNAAVQRVQVLPDVDTLLHFATESTPDGF
SCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETESEQPEESNENQDKEVEKPDSEK
DLLDDSDDDDIEILEECIISAMPTKSSRKAKKLAQTASKLPPPVARKPSQLPVYKLLPAQ
NRLQAQKHVSFTPGDDVPRVYCVEGTPINFSTATSLSDLTIESPPNELATGDGVRAGIQS
GEFEKRDTIPTEGRSTDDAQRGKISSIVTPDLDDNKAEEGDILAECINSAMPKGKSHKPF
RVKKIMDQVQQASSTSSGANKNQVDTKKKKPTSPVKPMPQNTEYRTRVRKNTDSKVNVNT
EETFSDNKDSKKPSLQTNAKAFNEKLPNNEDRVRGSFALDSPHHYTPIEGTPYCFSRNDS
LSSLDFDDDDVDLSREKAELRKGKESKDSEAKVTCRPEPNSSQQAASKSQASIKHPANRA
QSKPVLQKQPTFPQSSKDGPDRGAATDEKLQNFAIENTPVCFSRNSSLSSLSDIDQENNN
NKESEPIKEAEPANSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQ
ECISSAMPKKKRPSRLKSESEKQSPRKVGGILAEDLTLDLKDLQRPDSEHAFSPDSENFD
WKAIQEGANSIVSSLHQAAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPF
TSNKGPRILKPGEKSTLEAKKIESENKGIKGGKKVYKSLITGKIRSNSEISSQMKQPLPT
NMPSISRGRTMIHIPGLRNSSSSTSPVSKKGPPLKTPASKSPSEGPGATTSPRGTKPAGK
SELSPITRQTSQISGSNKGSSRSGSRDSTPSRPTQQPLSRPMQSPGRNSISPGRNGISPP
NKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQLSQQNLTKQASLSKNASSIPRSESASK
GLNQMSNGNGSNKKVELSRMSSTKSSGSESDRSERPALVRQSTFIKEAPSPTLRRKLEES
ASFESLSPSSRPDSPTRSQAQTPVLSPSLPDMSLSTHPSVQAGGWRKLPPNLSPTIEYND
GRPTKRHDIARSHSESPSRLPINRAGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSE
SSEKAKSEDERHVSSMPAPRQMKENQVPTKGTWRKIKESDISPTGMASQSASSGAASGAE
SKPLIYQMAPPVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSVSEKGSSSIKDSKD
THGKQSVGSGSPVQTVGLETRLNSFVQVEAPEQKGTEAKPGQSNPVSIAETAETCIAERT
PFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVSTNTKKRDSKT
DSTESSGAQSPKRHSGSYLVTSV
NT seq 8352 nt   +upstreamnt  +downstreamnt
atgacttctggacagattgacttactagagcgtcttaaagaatttaacttagatagtaat
ttccccggagtgaaactacgctcaaaaatgtcccttcgctcctacggaagtcgggaagga
tctgtatccagccgttcaggagaatgcagtcctgtccccatggggtcattcccaagaaga
acatttgtaaatggaagcagagagagtactgggtatctagaagagcttgaaaaagaaaga
tcattactccttgctgatcttgacaaagaagagaaggaaaaggactggtattatgctcaa
cttcagaacctcacaaaaagaatagatagcctgcctttaactgaaaatttttccttacag
acagacatgacaagacggcagctggagtatgaagcaaggcagatcagggctgcaatggag
gagcagcttggcacctgccaggacatggagaagcgtgcacagcgaagaatagccaggatc
cagcaaatagaaaaggacatactgcgcgtgcgccagcttttacagtcccaggcggcggaa
gcggagaggtcatctcagagcaggcatgatgctgcctcccatgaagctggccggcagcac
gaaggccacggagtggcagaaagcaacaccgcagcctccagtagtggtcagagtccagct
acacgtgtggatcacgaaacagccagtgttttgagttctagcggcacgcactctgctcct
cgaaggttgacaagtcatctggggacaaaggtggaaatggtgtattccttgttgtcaatg
cttggtactcatgataaggacgatatgtcacgaactttgctagctatgtccagctcccaa
gacagctgtatatccatgcggcagtctggatgtcttcctctcctcatccagcttttacat
ggcaatgacaaagactctgtattgttgggaaattcccggggcagtaaagaggctcgggcc
agggccagtgcagcactccacaacatcattcactcacagcctgatgacaagagaggcagg
cgtgaaatccgagtccttcatcttttggaacagatacgagcttactgtgaaacctgttgg
gagtggcaggaagcccacgaacaaggcatggaccaggacaaaaacccaatgccagctcct
gttgagcatcagatctgtcctgctgtgtgtgttctaatgaagctttcatttgatgaagag
cataggcatgcaatgaatgaacttgggggactgcaggccattgcagagttattgcaggtg
gactgtgagatgtatgggcttactaatgaccactacagtgttactttaagacggtatgct
ggaatggctttgacaaacttgacctttggagatgttgccaacaaggctacgctgtgttct
atgaaaggctgcatgagagcacttgtggcccagttaaaatctgagagtgaagacttacag
caggttattgcaagtgttttgaggaatttgtcttggcgagcagatgtaaatagcaaaaag
acgttgagagaagttggaagtgtgaaagcattgatggaatgtgctttggaagttaaaaag
gaatcaaccctcaaaagcgttttgagtgccttatggaacctgtctgcacactgcactgag
aataaggctgacatctgtgctgtggatggagcactggcatttctggttggcaccctcact
taccggagccagacaaatactttagccattattgaaagtggaggtgggatattacggaat
gtgtccagcttgatagctacaaacgaagaccacaggcaaatcctaagagagaacaattgc
ctacaaactttattacagcacttgaaatctcacagcttgacaatagtcagtaatgcatgt
ggaactttgtggaatctctcagcaagaaatcctaaagaccaggaagccttgtgggacatg
ggggcagtgagcatgctcaagaacctcattcattccaagcacaaaatgattgccatggga
agtgcagcagctttaaggaatctcatggcaaacagacctgcaaagtataaggatgccaat
atcatgtctcccggctcaagtctgccatcccttcacgttaggaaacagaaagctctagaa
gctgagctagatgctcagcatttatcagaaaccttcgacaacattgacaacctaagtccc
aaggcctctcaccggagtaagcagagacacaagcagaatctttatggtgactatgctttt
gacgccaatcgacatgatgatagtaggtcagacaatttcaatactggaaacatgactgtt
ctttcaccatatttaaatactacggtattgcccagctcttcttcctcaaggggaagttta
gacagttctcgttctgagaaagacagaagtttggagagagagcgaggtattggcctcagt
gcttaccatccaacaacagaaaatgcaggaacctcatcaaaacgaggtctgcagatcact
accactgcagcccagatagccaaagttatggaagaagtatcagccattcatacctcccag
gacgacagaagttctgcttctaccaccgagttccattgtgtggcagacgacaggagtgcg
gcacgaagaagctctgcctcccacacacactcaaacacatacaacttcactaagtcggaa
aattcaaataggacatgctctatgccttatgccaaagtggaatataaacgatcttcaaat
gacagtttaaatagtgtcactagtagtgatggatatggtaaaagaggccaaatgaaaccc
tcagttgaatcctattctgaagatgatgaaagtaaattttgcagttatggtcagtatcca
gctgacctagcccataagatacacagtgcaaatcatatggatgataatgatggagaactg
gatacaccaataaattacagtcttaaatattcagatgagcagttgaactcaggaaggcag
agtccctcacagaatgaaaggtgggcaagaccaaagcatgtgatagaagatgaaataaag
caaaacgagcaaagacaagcaagaagccagaacaccagttatcctgtctattctgagaat
accgatgacaaacacctcaaattccaaccacattttggacaacaagaatgtgtttcccca
tataggtcaaggggaaccagtggttcagaaacaaatcgaatgggttctagtcatgcaatt
aatcaaaatgtaaaccagtctctgtgtcaggaagatgattatgaagatgataaacctacc
aactacagtgaacgttattctgaggaagaacaacatgaagaagaagaagagagaccgaca
aattatagcataaaatataatgaagagaaacatcatgtggatcagcctattgattatagt
ttaaaatatgccactgacatttcttcctcacaaaaaccatcattttcattctcaaagaat
tcatcagcacaaagcactaaacctgaacatctctctccaagcagcgagaatacagctgta
cctccatctaatgccaaaaggcagaatcagctgcgtccaagttcagcacaaagaaatggc
cagactcaaaaaggcactacttgcaaagtcccctccatcaaccaagaaacaatacagact
tactgcgtagaagacaccccaatatgtttttcaaggtgcagttcattatcatcactgtca
tcagctgacgatgaaataggatgtgatcagacaacacaggaagcagattctgctaatact
ctgcagacagcagaagtaaaagagaatgatgtaactcggtcagctgaagatcctgcaact
gaagttccagcagtgtcccagaatgctagagccaaacccagccgactccaggcttctggc
ttatcttcagaatcaaccaggcataataaagctgttgagttttcttcaggagccaagtct
ccctccaaaagtggtgctcagacacccaaaagtcccccagaacactatgtccaggagact
ccgctcgtattcagcaggtgtacttctgtcagctcccttgacagttttgagagtcgctcc
attgccagctctgttcagagtgagccatgtagtggaatggtgagtggcatcataagcccc
agtgaccttccagatagtcctgggcagaccatgccaccaagcagaagcaaaacccctcca
cctcctccacagacagtgcaggccaagagagaggtgccaaaaagtaaagtccctgctgct
gagaagagagagagtgggcctaagcagactgctgtaaatgctgccgtgcagagggtgcag
gtccttccagacgtggatactttgttacacttcgccacagaaagtactccagacgggttt
tcttgttcctccagcctaagtgctctgagcctggatgagccatttatacagaaagatgta
gaattaagaatcatgcctccagttcaggaaaacgacaatgggaatgaaactgaatcagaa
cagcctgaggaatcaaatgaaaaccaggataaagaggtagaaaagcctgactctgaaaaa
gacttattagatgattctgatgacgatgatattgaaatattagaagaatgtattatttca
gccatgccaacaaagtcatcacgcaaagccaaaaaactagcccagactgcttcaaaatta
cctccacctgtggcaaggaaaccaagtcagctacctgtgtataaacttctgccagcacag
aataggctgcaggcacaaaaacatgttagctttacaccaggggatgatgtgccccgggtg
tactgtgtagaagggacacctataaacttttccacagcaacgtctctaagtgatctgaca
atagagtcccctccaaatgaattggctactggagatggggtcagagcgggtatacagtca
ggtgaatttgaaaaacgagataccattcctacagaaggcagaagtacagatgatgctcag
cgaggaaaaatctcatctatagttacaccagacctggatgacaacaaagcagaggaagga
gatattcttgcagaatgtatcaattctgctatgcccaaaggaaaaagccacaagcctttc
cgagtgaaaaagataatggaccaagtccaacaagcatcctcgacttcatctggagctaac
aaaaatcaagtagacactaagaaaaagaagcctacttcaccagtaaagcccatgccacaa
aatactgaatatagaacgcgtgtgagaaagaatacagactcaaaagttaatgtaaatact
gaagaaactttctcagacaacaaagactcaaagaaaccaagcttacaaaccaatgccaag
gccttcaatgaaaagctacctaacaatgaagacagagtgcgggggagcttcgccttggac
tcaccgcatcactacacccctattgaggggacgccgtactgcttttcccgaaatgactcc
ttgagttctctggattttgatgatgacgatgttgacctttccagggaaaaggccgagtta
agaaagggcaaagaaagcaaggattccgaagccaaagttacctgccgcccagaaccaaac
tcaagccagcaggcagctagtaagtcacaagccagtataaaacatccagcaaacagagca
cagtccaaaccagtgctgcagaaacagcccactttcccccagtcctccaaagacggacca
gatagaggggcagcaactgacgaaaaactgcagaattttgctattgaaaatactccagtt
tgcttttctcgaaattcctctctgagttcccttagtgacattgaccaggaaaacaacaat
aacaaagaaagtgaaccaatcaaagaagctgaacctgccaactcacaaggagagcccagt
aagcctcaggcatccgggtatgctcccaagtccttccacgtcgaagacacccctgtctgt
ttctcaagaaacagctctctcagttctcttagcattgactctgaggacgacctgttacag
gagtgtataagttctgccatgccaaaaaagaaaaggccttcaagactcaagagtgagagc
gaaaagcagagccctagaaaagtgggtggcatattagctgaagacctgacgcttgatttg
aaagatctacagaggccagattcagaacacgctttctcccccgactcagaaaattttgac
tggaaagctattcaggaaggcgcaaactccatagtaagtagtttgcaccaagctgctgca
gccgccgcgtgcttatctagacaagcgtcatccgactcagattccattctgtcactaaag
tccggcatttctctgggatcgccttttcatcttacacctgatcaagaggaaaagccattc
acaagcaataaaggcccaagaattctcaaacctggagagaaaagcacattagaagcaaaa
aaaatagaatctgaaaacaaaggaatcaaaggcgggaaaaaggtttataaaagcttgatt
acgggaaagattcgctccaattcagaaatttccagccaaatgaaacaacccctcccgaca
aacatgccttcaatctcaagaggcaggacgatgattcacatcccagggcttcggaatagc
tcctctagtacaagccctgtctctaagaaaggcccacccctcaagactccagcctctaaa
agccccagtgaagggccgggagctaccacttctcctcgaggaactaagccagcaggaaag
tcagagcttagccctatcaccaggcaaacttcccaaatcagtgggtcaaataaggggtct
tctagatcaggatctagagactccactccctcaagacctacacagcaaccattaagtagg
ccaatgcagtctccagggcgaaactcaatttcccctggtagaaatggaataagccctcct
aacaaactgtctcagctgcccagaacatcatctcccagtactgcttcaactaagtcctcc
ggttctgggaaaatgtcatatacatccccaggtagacagctgagccaacaaaatcttacc
aaacaagcaagtttatccaagaatgccagcagtatccccagaagtgagtcggcatctaaa
ggactgaatcagatgagtaacggcaatgggtcaaataaaaaggtagaactttctagaatg
tcttcaactaaatcaagtggaagtgaatcagacagatcagaaaggcctgcattagtacgc
cagtctactttcatcaaagaagccccaagcccaaccctgaggaggaaactggaggaatct
gcctcatttgaatccctttctccatcttctagaccagattctcccaccaggtcgcaggca
cagaccccagttttaagcccttcccttcctgatatgtctctgtccacacatccatctgtt
caggcaggtgggtggcgaaagctcccgcctaatctcagccccactatcgagtataatgac
ggaaggcccacaaaacggcatgatattgcacgctcccattctgaaagtccttccagacta
ccaatcaaccgggcgggaacctggaagcgtgaacacagcaaacattcctcgtcccttcct
cgagtgagtacttggagaagaactggaagctcatcttctattctttctgcttcatcagag
tccagtgaaaaagcaaaaagtgaggatgaaaggcatgtgagctccatgccagcacccaga
cagatgaaggaaaaccaggtgcccaccaaaggaacatggaggaaaatcaaggaaagtgac
atttctcccacaggcatggcttctcagagcgcttcctcaggtgctgccagtggtgctgaa
tccaagcctctgatctatcagatggcacctcctgtctctaaaacagaggatgtttgggtg
agaattgaggactgccccattaacaaccctagatctggacggtcccccacaggcaacacc
cccccagtgattgacagtgtttcagagaagggaagttcaagcattaaagattcaaaagac
acccatgggaaacagagtgtgggcagtggcagtcctgtgcaaaccgtgggtctggaaacc
cgcctcaactcctttgttcaggtagaggccccagaacagaaaggaactgaggcaaaacca
ggacagagtaacccagtctctatagcagagactgctgagacgtgtatagcagagcgtacc
cctttcagttccagtagctccagcaagcacagctcacctagcgggactgttgctgccaga
gtgacaccttttaattacaaccctagccctaggaagagcagcgcagacagcacttcagcc
cggccgtctcagatccctacgccagtgagcaccaacacgaagaagagagattcgaagact
gacagcacagaatccagtggagcccaaagtcctaaacgccattccgggtcttacctcgtg
acgtctgtttaa

KEGG   Mus musculus (mouse): 23805
Entry
23805             CDS       T01002                                 

Gene name
Apc2, A, AI852447, APCL, R75424
Definition
(RefSeq) APC regulator of WNT signaling pathway 2
  KO
K02085  adenomatosis polyposis coli protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04810  Regulation of actin cytoskeleton
mmu04934  Cushing syndrome
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05213  Endometrial cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    23805 (Apc2)
   04390 Hippo signaling pathway
    23805 (Apc2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    23805 (Apc2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    23805 (Apc2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    23805 (Apc2)
   05206 MicroRNAs in cancer
    23805 (Apc2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    23805 (Apc2)
   05225 Hepatocellular carcinoma
    23805 (Apc2)
   05226 Gastric cancer
    23805 (Apc2)
   05217 Basal cell carcinoma
    23805 (Apc2)
   05213 Endometrial cancer
    23805 (Apc2)
   05224 Breast cancer
    23805 (Apc2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    23805 (Apc2)
   05022 Pathways of neurodegeneration - multiple diseases
    23805 (Apc2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    23805 (Apc2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    23805 (Apc2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    23805 (Apc2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    23805 (Apc2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    23805 (Apc2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     23805 (Apc2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    23805 (Apc2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     23805 (Apc2)
SSDB
Motif
Pfam: APC_basic APC_rep APC_N_CC APC_r Arm_APC_u3 Suppressor_APC Arm SAMP bZIP_1 HALZ JIP_LZII
Other DBs
NCBI-GeneID: 23805
NCBI-ProteinID: NP_001359166
MGI: 1346052
Ensembl: ENSMUSG00000020135
Vega: OTTMUSG00000000013
LinkDB
Position
10; 10 C1
AA seq 2303 aa
MGLLGLLSLLHSAFFGNQALQELKMTSSMASYEQLVRQVEALKAENTHLRQELRDNSSHL
SKLETETSGMKEVLKHLQGKLEQEARVLVSSGQTEVLEQLKALQTDISSLYNLKFHAPAL
GPEPAARTPEGSPVHGSGPSKDSFGELSRATIRLLEELDQERCFLLSEIEKEEKEKLWYY
SQLQGLSKRLDELPHVDTFSMQMDLIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRAS
RLEQIDKELLEAQDRVQQTEPQALLAVKPVAVEEEQEAEVPTHPEDGTPQPGNSKVEVVF
WLLSMLATRDQEDTARTLLAMSSSPESCVAMRRSGCLPLLLQILHGTEAGSVGRAGIPGA
PGAKDARMRANAALHNIVFSQPDQGLARKEMRVLHVLEQIRAYCETCWDWLQARDSGTES
GTGDTPVPIEPQICQATCAVMKLSFDEEYRRAMNELGGLQAVAELLQVDYEMHKMTRDPL
NLALRRYAGMTLTNLTFGDVANKATLCARRGCMEAIVAQLGSESEELHQVVSSILRNLSW
RADINSKKVLREVGSMTALMECVLRASKESTLKSVLSALWNLSAHSTENKAAICQVDGAL
GFLVSTLTYRCQGNSLAVIESGGGILRNVSSLIATREDYRQVLRDHNCLQTLLQHLTSHS
LTIVSNACGTLWNLSARSPRDQELLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLAHR
PAKYQAAAMAVSPGTCVPSLYVRKQRALEAELDTRHLVHALGHLEKQSLPEAETTSKKPL
PPLRHLDGLVQDYASDSGCFDDDDAPSLAAAATTAEPASPAVMSMFLGGPFLQGQALART
PPARQGGLEAEKEAGGEAAVAAKAKAKLALAVARIDRLVEDISALHTSSDDSFSLSSGDP
GQEAPREGRAQSCSPCRGTEGGRREAGSRAHPLLRLKAAHTSLSNDSLNSGSTSDGYCTR
EHMTPCPLAALAEHRDDPVRGQTRPSRLDLDLPSRAELPARDTAATDARVRTIKLSPTYQ
HVPLLDGAAGAGVRPLVGPGTSPGARKQAWIPADSLSKVPEKLVASPLPIASKVLQKLVA
QDGPMSLSRCSSLSSLSSTGHAVPSQAENLDSDSSLEGLEEAGPGEAELGRAWRASGSTS
LPVSIPAPQRGRSRGLGVEDATPSSSSENCVQETPLVLSRCSSVSSLGSFESRSIASSIP
SDPCSGLGSGTVSPSELPDSPGQTMPPSRSKTPPAPPGQPETSQFSLQWESYVKRFLDIA
DCRERCQPPSELDAGSVRFTVEKPDENFSCASSLSALALHELYVQQDVELRLRPPACPER
AVGGGGHRRRDEAASRLDGPAPAGSRARSATDKELEALRECLGAAMPARLRKVASALVPG
RRSLPVPVYMLVPAPARGDDSGTDSAEGTPVNFSSAASLSDETLQGPSRDKPAGPGDRQK
PTGRAAPARQTRSHRPKAAGAGKSTEHTRGPCRNRAGLELPLSRPQSARSNRDSSCQTRT
RGDGALQSLCLTTPTEEAVYCFYDSDEEPPATAPPPRRASAIPRALKREKPAGRKETPSR
AAQPATLPVRAQPRLIVDETPPCYSLTSSASSLSEPEAPEQPANHARGPEQGSKQDSSPS
PRAEEELLQRCISLAMPRRRTQVPGSRRRKPRALRSDIRPTEITQKCQEEVAGSDPASDL
DSVEWQAIQEGANSIVTWLHQAAAKASLEASSESDSLLSLVSGVSAGSTLQPSKLRKGRK
PAAEAGGAWRPEKRGTTSTKINGSPRLPNGPEKAKGTQKMMAGESTMLRGRTVIYSAGPA
SRTQSKGISGPCTTPKKTGTSGTTQPETVTKAPSPEQQRSRSLHRPGKISELAALRHPPR
SATPPARLAKTPSSSSSQTSPASQPLPRRSPLATPTGGPLPGPGGSLVPKSPARALLAKQ
HKTQKSPVRIPFMQRPARRVPPPLARPSPEPGSRGRAGAEGTPGARGSRLGLVRMASARS
SGSESSDRSGFRRQLTFIKESPGLLRRRRSELSSADSTASTSQAASPRRGRPALPAVFLC
SSRCDELRVSPRQPLAAQRSPQAKPGLAPRAPRRTSSESPSRLPVRASPGRPETVKRYAS
LPHISVSRRSDSAVSVPTTQANATRRGSDGEARPLPRVAPPGTTWRRIKDEDVPHILRST
LPATALPLRVSSPEDSPAGTPQRKTSDAVVQTEDVATSKTNSSTSPSLESRDPPQAPASG
PVAPQGSDVDGPVLTKPPASAPFPHEGLSAVIAGFPTSRHGSPSRAARVPPFNYVPSPMA
AATMASDSAVEKAPVSSPASLLE
NT seq 6912 nt   +upstreamnt  +downstreamnt
atggggctcttgggactcctgagcctgctgcactcagccttctttgggaaccaggcactg
caggagttgaaaatgaccagctccatggcctcatatgagcagctggtgcgccaggtggag
gccctgaaggccgagaacactcacttaaggcaggagctgagggataactctagccatctc
tccaagcttgagacagagacttctggaatgaaggaggtcctgaaacacctccagggcaag
ctggagcaggaggcgagagtgctcgtgtcttccgggcagacagaagtgttagagcaactg
aaagctcttcagactgacatcagtagcctgtacaacctcaagtttcatgctccagccctg
ggcccggagcctgccgcccggactccagagggaagcccagtgcacggctctggaccatcc
aaggacagctttggagagctgagccgggccaccatccgcctgctggaagaactggaccag
gagagatgcttcctgctgagcgagatagagaaagaggagaaggagaagctatggtattac
tctcagctccagggcctgtccaagcgcttggatgagctgccgcacgtggacacgttttcg
atgcagatggatctgattcggcagcagctggagttcgaggcccagcacatccgctcgctg
atggaggagcgcttcggtacctccgacgagatggtgcagcgggcgcagatccgggcttcg
cgcttggagcagattgacaaggagctgttggaagcccaggaccgggtgcagcagacagag
cctcaggctctgctggcggtgaagcctgtggcagtagaggaggagcaggaggcagaagtc
cccacacatcctgaggatggcacccctcagcctggcaacagcaaggtggaggtggtgttc
tggcttctatctatgttggcaacgcgcgaccaggaagatactgcgcgcacactgctggcc
atgtccagctctccagagagctgtgtagccatgcgccgctcgggctgtctgccactgctg
ctccagatccttcatggcactgaggctgggtctgtggggcgcgcagggatccccggagcg
cctggtgccaaagatgcacgcatgcgcgccaatgcggccctgcacaacatcgttttctcc
cagccggatcagggcctggcacgcaaggagatgcgtgtgctgcatgtgctggagcagatc
cgagcctactgcgagacctgctgggactggcttcaggcgcgggacagcgggacagaaagt
ggtacaggagacactcctgtcccaatcgagccgcagatctgccaggctacctgtgcagtg
atgaagctgtcatttgacgaagaataccgtcgggctatgaatgagctaggggggctgcag
gctgtggcagaactactgcaggtggactatgaaatgcacaagatgacccgggacccactc
aaccttgccctgcgccgctacgctggcatgaccctcaccaacctcacctttggagacgtt
gccaacaaggccacactgtgtgcccgccgaggctgcatggaagccattgtggcccagctt
ggctctgagagcgaggagctgcatcaggttgtttccagtattctgcgtaatctgtcatgg
agggcagacatcaacagcaagaaggtgctgagggaggttggcagcatgaccgccttgatg
gaatgtgtgctgcgggcctccaaggagtcgaccctaaagagtgtgctcagtgctctgtgg
aacctgtcagcacacagcacagagaacaaggcagccatctgccaggtagatggtgcactg
ggtttcctggtgagcaccctcacataccgttgccaagggaactccctggcagtcatcgag
agtggcggtgggatcctgcgcaacgtgtcaagcctcattgccacacgggaggactacagg
caggtgctccgtgaccacaactgcctgcagacactgctgcagcacctcacatcacacagt
ttgaccatcgtgagcaatgcctgtggcaccctctggaacctgtctgcccgcagcccccgc
gatcaggaactgttgtgggacctgggggccgtgggcatgctacgcaacctcgtccactcc
aaacacaagatgatcgccatgggtagtgctgctgctctgcggaacctgctagcccaccga
cccgccaagtatcaggccgcagccatggctgtctccccaggcacctgcgtgcccagtctt
tacgtccgcaagcagagggctctggaagctgagttggacactcggcacctggtgcatgca
ctcggtcacttagagaagcagagtctgcctgaggcagagaccacttcaaagaagcccctg
ccacccctccgccacctggacgggctggtgcaggactatgcctctgattctggctgcttt
gacgatgatgatgcaccatccctggctgctgctgccaccacagctgagcccgccagccca
gcagtgatgtctatgttccttggcggtcccttccttcagggccaggcactggcccgcacc
ccacctgcccgccagggtggcctagaagccgagaaggaggctggtggggaggcagctgtg
gctgccaaggccaaggccaagctggcgttggctgtggctcggatcgacagattggtggag
gacatctctgccctgcacacctcatcagacgacagcttcagtctcagctcgggggaccct
gggcaggaggcgccaagggagggccgtgctcagtcctgctctccatgccggggcactgag
ggtgggaggcgtgaggctggcagccgggcgcaccctcttttgaggctcaaggcagcccac
actagcctctctaatgatagcttgaacagcggtagcaccagcgatggctactgtacccgg
gaacacatgacgccttgcccgctggctgcactggccgagcaccgtgatgaccctgtgcgc
ggacagactcggcccagccgactggacctggaccttcccagccgggctgagcttcctgcc
cgggacacagcagccaccgatgcccgagtgcgcacaatcaagttatccccaacctatcag
catgttccactgctggatggggccgctggggcaggtgttcgacccctggttgggccggga
acctccccgggggctcggaaacaggcatggatacctgcagacagcctgagcaaagtccct
gagaaactggtggcctctccactgcccatagctagcaaggtgctgcagaagctggtcgca
caggatgggccgatgtccctctccaggtgcagctctctgtcctctctatcttccacgggc
catgctgtccccagccaggcagagaaccttgacagcgattcatccctggaggggcttgag
gaggctggtcctggtgaggccgagctgggcagggcgtggcgagcatccgggtccacctct
cttccggtgtccatcccagccccgcagcgggggcgcagtagaggtcttggggtggaggat
gcaacaccatccagctcatctgagaactgcgtccaggagacgcctttggtcctgagccgt
tgtagttccgtgagctccctgggcagcttcgagagccgctccattgccagctccatcccc
agtgacccgtgcagcgggctgggcagtggcacagtgagtcccagcgagctgccagacagc
cccgggcagacgatgccaccgagccgcagcaagacgccaccggcacctcctgggcagcct
gagaccagccagttcagcctgcagtgggaaagctatgtgaagcgcttcctagacatcgca
gactgtcgagaaagatgccagccgccctcggagctggacgcgggcagcgttcgcttcaca
gtggagaagccagatgagaatttctcctgcgcctccagcctcagtgcactggcccttcat
gagctgtatgtccagcaggatgtggagctgcgtctgaggccacctgcctgcccagagcgt
gcggtgggtggtgggggccaccgtcggagggacgaggctgccagccgcctggatggtcca
gcaccagctggttctagggctcggtcagcaactgataaagaactggaggctttgcgtgaa
tgcctgggggcagccatgcccgcccggctccgcaaggtggcctcggccttggtgcctggc
cgccgctcattgccagtccctgtgtacatgttagtgcccgccccggctcggggtgatgac
tcgggcacggactccgcagagggcacacccgttaacttttccagtgcagcctcgctcagt
gacgagaccttacagggaccctccagggacaagccagccgggcctggggacaggcagaaa
cctacaggccgagctgcccctgccaggcagacccgatctcaccggcccaaagcagcaggc
gctggtaagagcacagaacacacccgggggccctgtaggaaccgggcaggattggagcta
ccactcagcaggccccagagtgctcggtccaacagggatagctcatgccagacccggacc
cgcggagatggtgccctgcagtcgctatgcctcacaacacccacagaggaagctgtgtac
tgcttctatgactctgatgaggaaccaccagccactgcaccaccacctcggcgggcatcc
gccatcccacgggctctaaagcgcgagaaaccggcaggcagaaaggagactccatccagg
gcagcccagcctgccacactccctgtgagagcccaacccagactgatcgtggatgagacc
ccgccctgctattccctgacttcctcagctagttccctcagtgagcctgaggcccctgaa
cagccggccaaccatgctcgaggcccggagcagggtagtaaacaggacagctctcctagc
ccaagggcagaagaggaacttctgcagagatgtatcagcttggccatgcccaggcgccgg
acccaggtgcctggctcacggcgtcgcaagcccagagccttgaggtcagacataaggccc
actgagataacccagaaatgccaggaggaggtggctggctccgatccagcctctgaccta
gacagtgtggagtggcaggctatccaagagggcgcaaactccattgtcacatggctgcat
caggcagcggccaaagccagcctggaagcatcttctgagtctgactccctcttgtctttg
gtgtccggggtgtcagcaggctccaccctccagccctccaagctcaggaaagggcgaaag
cctgcagcagaggctggaggtgcctggcgtcctgagaaacggggcacaacttccactaag
atcaatgggagtccccggctacctaacggtcctgagaaggcaaagggtacccagaaaatg
atggcaggggagtcaaccatgctccggggacggacagtgatctactcagccggcccagcc
tcccgcactcagtccaaaggtatttctggaccttgtaccacacctaagaagacagggaca
tctggtaccactcagccagaaactgtcaccaaagcccccagccctgagcaacaacgttca
cggagcctccaccgaccgggcaagatctctgagctggcagctttgcgccacccgcccagg
agtgccactcctccagcccgcctcgccaagaccccgtcctcaagctcttcacagacctct
ccagcatcccagcccctgcctaggcggtcccctctggccactcccacaggaggacctctg
cctggccctggggggtccctggtgcccaagtcaccagcacgggcccttctggctaagcaa
cacaagacccagaagtcacctgtgcggatcccattcatgcaaaggccagccaggcgagtg
ccacctccactggccaggccatccccagaacctggctctaggggccgagctggggctgag
ggtactcctggggcacgtggcagccgcctgggcctggtgcgtatggcttcagctcgctcc
agtggcagcgagtcctcggatcgctcaggcttccgaagacagctgactttcatcaaggaa
tccccaggtctccttcggcgtcgcagatcagagctgtcctctgcggactccacggcctcc
acctcccaggctgcttcgccccgccgtggacggcctgcactccctgctgtctttctctgc
tcctctcgttgcgatgagctgcgggtatccccacggcagcccctggcagcacagaggtcc
ccacaggccaagccaggtctcgccccacgtgcgcccagacgcaccagctctgagagcccc
tcacgcctgcctgtgcgggcgagccctggacggcctgagacagtcaagcggtacgcatcc
ctgccacatattagtgtgtcccgcaggtccgatagcgctgtctctgtgcccaccacccag
gccaatgccactcgccggggaagtgatggcgaggccaggccgctgcccagggtagctcct
ccgggtacgacctggcgtcgaatcaaagatgaagatgtcccccacatcctgcgcagcaca
ctgcctgccactgccctgcctctcagggtctcgtcacccgaagacagccccgctggaact
ccacagcgcaagaccagtgacgcagtggtgcaaacagaggacgtggccacttctaagacc
aactctagcacgtcacctagcctggagagcagggatccgccacaggcccctgccagcggc
cctgtggctccccagggcagcgatgtggatggaccagtactcaccaagcctcctgcctca
gcgcccttcccccatgagggtctgagtgctgtcatagcaggctttcccaccagcaggcat
ggctcccccagcagggctgcacgggttccccccttcaactatgtgcccagccctatggca
gcggccacaatggccagtgactccgcagtggagaaagccccggtctcctctccagccagt
ctcctggagtag

DBGET integrated database retrieval system