KEGG   Mus musculus (mouse): 13190
Entry
13190             CDS       T01002                                 

Gene name
Dct, DT, TR, TRP, TRP-2, TRP2, Tyr, Tyrp, Tyrp-2, Tyrp2, slaty, slt
Definition
(RefSeq) dopachrome tautomerase
  KO
K01827  dopachrome tautomerase [EC:5.3.3.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00350  Tyrosine metabolism
mmu01100  Metabolic pathways
mmu04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    13190 (Dct)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    13190 (Dct)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.12  L-dopachrome isomerase
     13190 (Dct)
SSDB
Motif
Pfam: Tyrosinase
Other DBs
NCBI-GeneID: 13190
NCBI-ProteinID: NP_034154
MGI: 102563
Ensembl: ENSMUSG00000022129
UniProt: P29812
LinkDB
Position
14 E4; 14 61.6 cM
AA seq 517 aa
MGLVGWGLLLGCLGCGILLRARAQFPRVCMTLDGVLNKECCPPLGPEATNICGFLEGRGQ
CAEVQTDTRPWSGPYILRNQDDREQWPRKFFNRTCKCTGNFAGYNCGGCKFGWTGPDCNR
KKPAILRRNIHSLTAQEREQFLGALDLAKKSIHPDYVITTQHWLGLLGPNGTQPQIANCS
VYDFFVWLHYYSVRDTLLGPGRPYKAIDFSHQGPAFVTWHRYHLLWLERELQRLTGNESF
ALPYWNFATGKNECDVCTDELLGAARQDDPTLISRNSRFSTWEIVCDSLDDYNRRVTLCN
GTYEGLLRRNKVGRNNEKLPTLKNVQDCLSLQKFDSPPFFQNSTFSFRNALEGFDKADGT
LDSQVMNLHNLAHSFLNGTNALPHSAANDPVFVVLHSFTDAIFDEWLKRNNPSTDAWPQE
LAPIGHNRMYNMVPFFPPVTNEELFLTAEQLGYNYAVDLSEEEAPVWSTTLSVVIGILGA
FVLLLGLLAFLQYRRLRKGYAPLMETGLSSKRYTEEA
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgggccttgtgggatgggggcttctgctgggttgtctgggctgcggaattctgctcaga
gctcgggctcagtttccccgagtctgcatgaccttggatggcgtgctgaacaaggaatgc
tgcccgcctctgggtcccgaggcaaccaacatctgtggatttctagagggcagggggcag
tgcgcagaggtgcaaacagacaccagaccctggagtggcccttatatccttcgaaaccag
gatgaccgtgagcaatggccgagaaaattcttcaaccggacatgcaaatgcacaggaaac
tttgctggttataattgtggaggctgcaagttcggctggaccggccccgactgtaatcgg
aagaagccggccatcctaagacggaatatccattccctgactgcccaggagagggagcag
ttcttgggcgccttagacctggccaagaagagtatccatccagactacgtgatcaccacg
caacactggctggggctgctcggacccaacgggacccagccccagatcgccaactgcagc
gtgtatgacttttttgtgtggctccattattattctgttcgagacacattattaggtcca
ggacgcccctataaggccattgatttctctcaccaagggcctgcctttgtcacgtggcac
aggtaccatctgttgtggctggaaagagaactccagagactcactggcaatgagtccttt
gcgttgccctactggaactttgcaaccgggaagaacgagtgtgacgtgtgcacagacgag
ctgcttggagcagcaagacaagatgacccaacgctgattagtcggaactcgagattctct
acctgggagattgtgtgcgacagcttggatgactacaaccgccgggtcacactgtgtaat
ggaacctatgaaggtttgctgagaagaaacaaagtaggcagaaataatgagaaactgcca
accttaaaaaatgtgcaagattgcctgtctctccagaagtttgacagccctcccttcttc
cagaactctaccttcagcttcaggaatgcactggaagggtttgataaagcagacggaaca
ctggactctcaagtcatgaaccttcataacttggctcactccttcctgaatgggaccaat
gccttgccacactcagcagccaacgaccctgtgtttgtggtcctccactcttttacagac
gccatctttgatgagtggctgaagagaaacaacccttccacagatgcctggcctcaggaa
ctggcacccattggtcacaaccgaatgtataacatggtccccttcttcccaccggtgact
aatgaggagctcttcctaaccgcagagcaacttggctacaattacgccgttgatctgtca
gaggaagaagctccagtttggtccacaactctctcagtggtcattggaatcctgggagct
ttcgtcttgctcttggggttgctggcttttcttcaatacagaaggcttcgcaaaggctat
gcgcccttaatggagacaggtctcagcagcaagagatacacggaggaagcctag

DBGET integrated database retrieval system