KEGG   Mus musculus (mouse): 16183
Entry
16183             CDS       T01002                                 

Gene name
Il2, IL, Il-2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04151  PI3K-Akt signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu04940  Type I diabetes mellitus
mmu05135  Yersinia infection
mmu05142  Chagas disease
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
mmu05321  Inflammatory bowel disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16183 (Il2)
   04151 PI3K-Akt signaling pathway
    16183 (Il2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16183 (Il2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16183 (Il2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    16183 (Il2)
   04660 T cell receptor signaling pathway
    16183 (Il2)
   04658 Th1 and Th2 cell differentiation
    16183 (Il2)
   04659 Th17 cell differentiation
    16183 (Il2)
   04672 Intestinal immune network for IgA production
    16183 (Il2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16183 (Il2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    16183 (Il2)
   05321 Inflammatory bowel disease
    16183 (Il2)
   05330 Allograft rejection
    16183 (Il2)
   05332 Graft-versus-host disease
    16183 (Il2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    16183 (Il2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    16183 (Il2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16183 (Il2)
   05162 Measles
    16183 (Il2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    16183 (Il2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16183 (Il2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    16183 (Il2)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   16183 (Il2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Cytokines
   16183 (Il2)
SSDB
Motif
Pfam: IL2 DivIC RSF DUF773 FlaG
Other DBs
NCBI-GeneID: 16183
NCBI-ProteinID: NP_032392
MGI: 96548
Ensembl: ENSMUSG00000027720
Vega: OTTMUSG00000007347
UniProt: P04351
LinkDB
Structure
PDB: 
4YUE 4YQX

Position
3 B; 3 18.3 cM
AA seq 169 aa
MYSMQLASCVTLTLVLLVNSAPTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLS
RMENYRNLKLPRMLTFKFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENF
ISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRRWIAFCQSIISTSPQ
NT seq 510 nt   +upstreamnt  +downstreamnt
atgtacagcatgcagctcgcatcctgtgtcacattgacacttgtgctccttgtcaacagc
gcacccacttcaagctccacttcaagctctacagcggaagcacagcagcagcagcagcag
cagcagcagcagcagcagcacctggagcagctgttgatggacctacaggagctcctgagc
aggatggagaattacaggaacctgaaactccccaggatgctcaccttcaaattttacttg
cccaagcaggccacagaattgaaagatcttcagtgcctagaagatgaacttggacctctg
cggcatgttctggatttgactcaaagcaaaagctttcaattggaagatgctgagaatttc
atcagcaatatcagagtaactgttgtaaaactaaagggctctgacaacacatttgagtgc
caattcgatgatgagtcagcaactgtggtggactttctgaggagatggatagccttctgt
caaagcatcatctcaacaagccctcaataa

DBGET integrated database retrieval system