KEGG   Mus musculus (mouse): 16881Help
Entry
16881             CDS       T01002                                 

Gene name
Lig1, AL033288, LigI
Definition
(RefSeq) ligase I, DNA, ATP-dependent
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    16881 (Lig1)
   03410 Base excision repair
    16881 (Lig1)
   03420 Nucleotide excision repair
    16881 (Lig1)
   03430 Mismatch repair
    16881 (Lig1)
Enzymes [BR:mmu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     16881 (Lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     16881 (Lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     16881 (Lig1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    16881 (Lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     16881 (Lig1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     16881 (Lig1)
   NER (nucleotide excision repair)
    Other NER factors
     16881 (Lig1)
   MMR (mismatch exicision repair)
    Other MMR factors
     16881 (Lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR PucR
Motif
Other DBs
NCBI-GeneID: 16881
NCBI-ProteinID: NP_034845
MGI: 101789
Ensembl: ENSMUSG00000056394
UniProt: P37913 Q3U4X8 Q3TSU8
LinkDB All DBs
Position
7 A1; 7 7.82 cM
AA seq 932 aa AA seqDB search
MRKKEQERKGETSAANMQRSIMSFFQPTKEGKAKKPEKETPSSIREKEPPPKVALKERNQ
VVPESDSPVKRTGRKVAQVLSCEGEDEDEAPGTPKVQKPVSDSEQSSPPSPDTCPENSPV
FNCSSPMDISPSGFPKRRTARKQLPKRTIQDTLEEQNEDKTKTAKKRKKEEETPKESLAE
AEDVKQKEEKEGDQLIVPSEPTKSPESVTLTKTENIPVCKAGVKLKPQEEEQSKPPARGA
KTLSSFFTPRKPAVKTEVKQEESGTLRKEETKGTLDPANYNPSKNNYHPIEDACWKHGQK
VPFLAVARTFEKIEEVSARLKMVETLSNLLRSVVALSPPDLLPVLYLSLNRLGPPQQGLE
LGVGDGVLLKAVAQATGRQLESIRAEVAEKGDVGLVAENSRSTQRLMLPPPPLTISGVFT
KFCDIARLTGSASMAKKMDIIKGLFVACRHSEARYIARSLSGRLRLGLAEQSVLAALAQA
VSLTPPGQEFPTAVVDAGKGKTAEARKMWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLE
RLPEHCKLSPGVPLKPMLAHPTRGVSEVLKRFEEVDFTCEYKYDGQRAQIHVLEGGEVKI
FSRNQEDNTGKYPDIISRIPKIKHPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEV
DASEIQVQVCLYAFDLIYLNGESLVRQPLSRRRQLLRENFVETEGEFVFTTSLDTKDTEQ
IAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYL
GRGKRAGRYGGFLLAAYDEESEELQAICKLGTGFSDEELEEHHQSLQALVLPTPRPYVRI
DGAVAPDHWLDPSIVWEVKCADLSLSPIYPAARGLVDKEKGISLRFPRFIRVRKDKQPEQ
ATTSNQVASLYRKQSQIQNQQSSDLDSDVEDY
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaagagcaagagaggaaaggagagacttctgctgccaacatgcagagaagt
attatgtcattttttcaacccacaaaagaaggtaaagcgaagaagccagagaaggagaca
cccagcagcatcagagagaaggaaccccctccaaaggtggcgctgaaggagaggaatcaa
gtggtgcccgagagtgattctccagtgaagaggacaggaaggaaggtagcccaggttctg
agctgtgaaggggaggacgaagatgaagcccctggcacccccaaagtccagaagcctgtg
tcagactctgaacagagctctcctcccagccctgacacatgtcctgagaacagtcctgtc
ttcaactgcagctcccccatggacatctccccatcaggattcccaaagcgtcgaactgcg
cggaagcagctccccaaacggacaattcaagacactcttgaggagcagaatgaggacaaa
accaaaacagctaagaaaaggaagaaagaagaagagaccccaaaagaaagcctcgcagag
gctgaagacgtaaaacagaaggaagaaaaggagggggaccagctcatagtcccctctgag
cccacaaagtcccctgagtcagtaaccctgacaaagacagagaacattccagtgtgtaag
gcaggagtgaaactgaagcctcaggaagaggaacagagcaaacctcctgctagaggtgcc
aagacactgagcagtttcttcacaccccgaaaaccagcagtgaaaactgaagtcaaacaa
gaagagtcaggcactctaaggaaggaagagaccaagggaaccctggatccagcaaattat
aatccttccaagaataactatcatcccattgaagatgcctgctggaaacatggccagaag
gtcccttttctcgccgtggcccggacatttgagaagattgaggaggtttctgctaggctc
aagatggtggagacattgagcaacctgctgcgctccgtggtggccctgtcccctccagac
ttgctccctgttctctatctcagcctcaaccgcctcgggccacctcagcagggactagag
ctgggtgttggtgatggtgtcctcctcaaggccgttgcccaggccacaggtcgtcagctg
gagtccatccgggctgaggtagctgagaagggggatgtggggctggtggccgagaacagc
cgcagcactcagagactcatgctgcctccacctccacttactatttctggagtcttcacc
aaattctgtgacattgcccggctcactggcagtgcttccatggccaagaagatggacatt
atcaagggcctttttgttgcctgccgccactcagaagccaggtacattgccaggtcccta
agcgggcggctgcgccttggcctagctgagcagtcggtactggctgctcttgcccaggct
gtgagcctcacaccccctggccaagaatttcccacggcggtggtggatgctgggaagggc
aagacagcagaggccagaaagatgtggttggaagaacaaggcatgatcttgaagcagacc
ttctgtgaggttcctgacctggatcgaatcatccctgtgctgctggaacatggcctggaa
cgtctcccagagcactgcaagctgagcccaggggtccctcttaaaccaatgctggctcat
cccactcggggtgtcagtgaggtcctaaaacgctttgaggaggtcgacttcacctgtgaa
tataaatacgatgggcagcgagcacagatacatgttctggaaggtggagaagtgaagatc
ttcagcaggaaccaggaagacaacacaggaaagtatcctgacattatcagccgcatcccc
aagattaaacacccctcagtcacatctttcattctggacactgaggctgtggcctgggac
cgggaaaagaagcagatccaaccattccaagtactcaccacgcgcaagcgcaaggaggtt
gatgcatcggagatacaggtgcaagtgtgtctgtatgcttttgacctcatctacctcaac
ggagagtccctggttcgccagcccctgtctcgacgccggcagctgctccgtgagaacttc
gtggagacagagggtgagtttgtcttcaccacctctttggacaccaaggacaccgagcag
attgctgagttcttggagcagtcagtgaaggactcctgtgagggcctgatggtgaagacc
ttggatgttgatgccacttatgagattgccaagaggtcacacaactggctcaagctgaag
aaggactaccttgacggtgtgggtgacactctggaccttgtggtgattggtgcctacctg
ggccgggggaagcgggctggccggtatggaggcttcctgttggctgcctacgatgaggag
agtgaagagcttcaggctatatgcaagctgggaactggattcagcgatgaggagctggag
gaacaccaccagagcctgcaggccctggtattgcctaccccacgcccctatgtgaggatt
gatggggcagtggccccagaccattggctggacccaagcattgtgtgggaggtgaagtgt
gctgatctttccctgtcccccatctaccctgctgcacggggcctggtggacaaagaaaaa
gggatctctcttcgttttcctcggttcattcgtgtccgtaaagacaagcagccagagcag
gccactaccagtaaccaggttgcctctttgtaccggaagcagagtcagattcagaaccaa
caaagctcagacttggactccgacgttgaagactattaa

DBGET integrated database retrieval system