KEGG   Mus musculus (mouse): 16881Help
Entry
16881             CDS       T01002                                 

Gene name
Lig1, AL033288, LigI
Definition
(RefSeq) ligase I, DNA, ATP-dependent
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    16881 (Lig1)
   03410 Base excision repair
    16881 (Lig1)
   03420 Nucleotide excision repair
    16881 (Lig1)
   03430 Mismatch repair
    16881 (Lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    16881 (Lig1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    16881 (Lig1)
Enzymes [BR:mmu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     16881 (Lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     16881 (Lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     16881 (Lig1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    16881 (Lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     16881 (Lig1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     16881 (Lig1)
   NER (nucleotide excision repair)
    Other NER factors
     16881 (Lig1)
   MMR (mismatch exicision repair)
    Other MMR factors
     16881 (Lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR PucR
Motif
Other DBs
NCBI-GeneID: 16881
NCBI-ProteinID: NP_034845
MGI: 101789
Ensembl: ENSMUSG00000056394
UniProt: P37913 Q3U4X8 Q3TSU8
LinkDB All DBs
Position
7 A1; 7 7.82 cM
AA seq 932 aa AA seqDB search
MRKKEQERKGETSAANMQRSIMSFFQPTKEGKAKKPEKETPSSIREKEPPPKVALKERNQ
VVPESDSPVKRTGRKVAQVLSCEGEDEDEAPGTPKVQKPVSDSEQSSPPSPDTCPENSPV
FNCSSPMDISPSGFPKRRTARKQLPKRTIQDTLEEQNEDKTKTAKKRKKEEETPKESLAE
AEDVKQKEEKEGDQLIVPSEPTKSPESVTLTKTENIPVCKAGVKLKPQEEEQSKPPARGA
KTLSSFFTPRKPAVKTEVKQEESGTLRKEETKGTLDPANYNPSKNNYHPIEDACWKHGQK
VPFLAVARTFEKIEEVSARLKMVETLSNLLRSVVALSPPDLLPVLYLSLNRLGPPQQGLE
LGVGDGVLLKAVAQATGRQLESIRAEVAEKGDVGLVAENSRSTQRLMLPPPPLTISGVFT
KFCDIARLTGSASMAKKMDIIKGLFVACRHSEARYIARSLSGRLRLGLAEQSVLAALAQA
VSLTPPGQEFPTAVVDAGKGKTAEARKMWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLE
RLPEHCKLSPGVPLKPMLAHPTRGVSEVLKRFEEVDFTCEYKYDGQRAQIHVLEGGEVKI
FSRNQEDNTGKYPDIISRIPKIKHPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEV
DASEIQVQVCLYAFDLIYLNGESLVRQPLSRRRQLLRENFVETEGEFVFTTSLDTKDTEQ
IAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYL
GRGKRAGRYGGFLLAAYDEESEELQAICKLGTGFSDEELEEHHQSLQALVLPTPRPYVRI
DGAVAPDHWLDPSIVWEVKCADLSLSPIYPAARGLVDKEKGISLRFPRFIRVRKDKQPEQ
ATTSNQVASLYRKQSQIQNQQSSDLDSDVEDY
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaagagcaagagaggaaaggagagacttctgctgccaacatgcagagaagt
attatgtcattttttcaacccacaaaagaaggtaaagcgaagaagccagagaaggagaca
cccagcagcatcagagagaaggaaccccctccaaaggtggcgctgaaggagaggaatcaa
gtggtgcccgagagtgattctccagtgaagaggacaggaaggaaggtagcccaggttctg
agctgtgaaggggaggacgaagatgaagcccctggcacccccaaagtccagaagcctgtg
tcagactctgaacagagctctcctcccagccctgacacatgtcctgagaacagtcctgtc
ttcaactgcagctcccccatggacatctccccatcaggattcccaaagcgtcgaactgcg
cggaagcagctccccaaacggacaattcaagacactcttgaggagcagaatgaggacaaa
accaaaacagctaagaaaaggaagaaagaagaagagaccccaaaagaaagcctcgcagag
gctgaagacgtaaaacagaaggaagaaaaggagggggaccagctcatagtcccctctgag
cccacaaagtcccctgagtcagtaaccctgacaaagacagagaacattccagtgtgtaag
gcaggagtgaaactgaagcctcaggaagaggaacagagcaaacctcctgctagaggtgcc
aagacactgagcagtttcttcacaccccgaaaaccagcagtgaaaactgaagtcaaacaa
gaagagtcaggcactctaaggaaggaagagaccaagggaaccctggatccagcaaattat
aatccttccaagaataactatcatcccattgaagatgcctgctggaaacatggccagaag
gtcccttttctcgccgtggcccggacatttgagaagattgaggaggtttctgctaggctc
aagatggtggagacattgagcaacctgctgcgctccgtggtggccctgtcccctccagac
ttgctccctgttctctatctcagcctcaaccgcctcgggccacctcagcagggactagag
ctgggtgttggtgatggtgtcctcctcaaggccgttgcccaggccacaggtcgtcagctg
gagtccatccgggctgaggtagctgagaagggggatgtggggctggtggccgagaacagc
cgcagcactcagagactcatgctgcctccacctccacttactatttctggagtcttcacc
aaattctgtgacattgcccggctcactggcagtgcttccatggccaagaagatggacatt
atcaagggcctttttgttgcctgccgccactcagaagccaggtacattgccaggtcccta
agcgggcggctgcgccttggcctagctgagcagtcggtactggctgctcttgcccaggct
gtgagcctcacaccccctggccaagaatttcccacggcggtggtggatgctgggaagggc
aagacagcagaggccagaaagatgtggttggaagaacaaggcatgatcttgaagcagacc
ttctgtgaggttcctgacctggatcgaatcatccctgtgctgctggaacatggcctggaa
cgtctcccagagcactgcaagctgagcccaggggtccctcttaaaccaatgctggctcat
cccactcggggtgtcagtgaggtcctaaaacgctttgaggaggtcgacttcacctgtgaa
tataaatacgatgggcagcgagcacagatacatgttctggaaggtggagaagtgaagatc
ttcagcaggaaccaggaagacaacacaggaaagtatcctgacattatcagccgcatcccc
aagattaaacacccctcagtcacatctttcattctggacactgaggctgtggcctgggac
cgggaaaagaagcagatccaaccattccaagtactcaccacgcgcaagcgcaaggaggtt
gatgcatcggagatacaggtgcaagtgtgtctgtatgcttttgacctcatctacctcaac
ggagagtccctggttcgccagcccctgtctcgacgccggcagctgctccgtgagaacttc
gtggagacagagggtgagtttgtcttcaccacctctttggacaccaaggacaccgagcag
attgctgagttcttggagcagtcagtgaaggactcctgtgagggcctgatggtgaagacc
ttggatgttgatgccacttatgagattgccaagaggtcacacaactggctcaagctgaag
aaggactaccttgacggtgtgggtgacactctggaccttgtggtgattggtgcctacctg
ggccgggggaagcgggctggccggtatggaggcttcctgttggctgcctacgatgaggag
agtgaagagcttcaggctatatgcaagctgggaactggattcagcgatgaggagctggag
gaacaccaccagagcctgcaggccctggtattgcctaccccacgcccctatgtgaggatt
gatggggcagtggccccagaccattggctggacccaagcattgtgtgggaggtgaagtgt
gctgatctttccctgtcccccatctaccctgctgcacggggcctggtggacaaagaaaaa
gggatctctcttcgttttcctcggttcattcgtgtccgtaaagacaagcagccagagcag
gccactaccagtaaccaggttgcctctttgtaccggaagcagagtcagattcagaaccaa
caaagctcagacttggactccgacgttgaagactattaa

DBGET integrated database retrieval system