KEGG   Mus musculus (mouse): 19224Help
Entry
19224             CDS       T01002                                 

Gene name
Ptgs1, COX1, Cox-1, Cox-3, PGHS-1, PHS_1, Pghs1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00590  Arachidonic acid metabolism
mmu01100  Metabolic pathways
mmu04611  Platelet activation
mmu04726  Serotonergic synapse
mmu04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    19224 (Ptgs1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    19224 (Ptgs1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    19224 (Ptgs1)
  09156 Nervous system
   04726 Serotonergic synapse
    19224 (Ptgs1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     19224 (Ptgs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 19224
NCBI-ProteinID: NP_032995
MGI: 97797
Ensembl: ENSMUSG00000047250
Vega: OTTMUSG00000012142
UniProt: P22437 Q543T1
LinkDB All DBs
Position
2 B; 2 24.19 cM
AA seq 602 aa AA seqDB search
MSRRSLSLWFPLLLLLLLPPTPSVLLADPGVPSPVNPCCYYPCQNQGVCVRFGLDNYQCD
CTRTGYSGPNCTIPEIWTWLRNSLRPSPSFTHFLLTHGYWLWEFVNATFIREVLMRLVLT
VRSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDVQLLA
QQLLLRREFIPAPQGTNILFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNL
ERQYHLRLFKDGKLKYQVLDGEVYPPSVEQASVLMRYPPGVPPERQMAVGQEVFGLLPGL
MLFSTIWLREHNRVCDLLKEEHPTWDDEQLFQTTRLILIGETIKIVIEEYVQHLSGYFLQ
LKFDPELLFRAQFQYRNRIAMEFNHLYHWHPLMPNSFQVGSQEYSYEQFLFNTSMLVDYG
VEALVDAFSRQRAGRIGGGRNFDYHVLHVAVDVIKESREMRLQPFNEYRKRFGLKPYTSF
QELTGEKEMAAELEELYGDIDALEFYPGLLLEKCQPNSIFGESMIEMGAPFSLKGLLGNP
ICSPEYWKPSTFGGDVGFNLVNTASLKKLVCLNTKTCPYVSFRVPDYPGDDGSVLVRRST
EL
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaaggagtctctcgctctggtttcccctgctgctgctcctgctgctgccgccg
acaccctcggtcctgctcgcagatcctggggtgccctcaccagtcaatccctgttgttac
tatccgtgccagaaccagggtgtctgtgtccgctttggcctcgacaactaccagtgtgat
tgtactcgcacgggctactcaggccccaactgtaccatccctgagatctggacctggctt
cggaattctctgcggcccagcccctcgttcacccatttcctgctgacacatggatactgg
ctctgggaatttgtgaatgccaccttcatccgagaagtactcatgcgcctggtactcaca
gtgcggtccaaccttatccccagccctccgacctacaactcagcgcatgactacatcagc
tgggagtccttctccaatgtgagctactatactcgcattctgccctctgtacccaaagac
tgccccacacccatggggaccaaagggaagaaacagttaccagatgttcagcttctggcc
caacagctgctgctgagaagggagttcattcctgccccccagggcaccaacatcctgttt
gccttctttgcacaacacttcacccaccagttcttcaagacctctggaaagatgggtcct
ggctttaccaaggccttaggccacggggtagaccttggccacatttatggagataatctg
gaacgacagtatcacctgcggctcttcaaggatgggaaacttaagtaccaggtgctggac
ggagaggtgtacccaccttccgtggaacaggcgtccgtgttgatgcgctacccaccaggt
gtcccgcctgaaaggcagatggctgtgggccaggaggtgtttgggttgcttccggggctg
atgctcttctccacgatctggcttcgtgaacataaccgcgtgtgcgacctgctgaaggag
gagcatcccacgtgggatgatgagcagctcttccagaccactcgcctcatccttatagga
gaaaccatcaaaattgtcattgaggagtatgtgcagcacttgagtggctatttcctgcag
ctcaagtttgacccggagctgctgttccgagcccagttccaatatcgaaaccgcatcgcc
atggaatttaaccatctctatcactggcatccactcatgcccaactccttccaagtgggc
tcacaagagtacagctacgagcagtttttatttaacacttctatgctggtggactatggg
gttgaggcactggtggatgccttctctcgccagagggctggccggattggtggaggtagg
aactttgactatcatgttctgcatgtggctgtggatgtcatcaaggagtcccgagagatg
cgcctacagcccttcaatgaataccgaaagaggtttggcttgaagccttacacctctttc
caggagctcacaggagagaaggagatggctgctgagttggaggagctgtacggtgacatc
gatgctttagagttctacccggggttgctgctggagaagtgccagcccaactccatcttt
ggagaaagtatgatagagatgggggctcccttttccctcaagggcctcctagggaatccc
atctgttccccagagtactggaaacccagcacgttcggtggtgacgtgggcttcaacctt
gtcaacacagcctcactgaagaaactggtctgcctcaacaccaagacctgcccctatgtt
tccttccgtgtgccagattaccctggagatgacgggtctgtcttagtgagacgctccact
gagctctga

DBGET integrated database retrieval system