Mus musculus (house mouse): 21802 Help Entry 21802             CDS       T01002                                  Symbol Tgfa, wa-1, wa1 Name (RefSeq) transforming growth factor alpha   KO K08774   transforming growth factor, alpha Organism mmu  Mus musculus (house mouse) Pathway mmu01521   EGFR tyrosine kinase inhibitor resistance mmu04010   MAPK signaling pathway mmu04012   ErbB signaling pathway mmu04014   Ras signaling pathway mmu04020   Calcium signaling pathway mmu04151   PI3K-Akt signaling pathway mmu04915   Estrogen signaling pathway mmu05200   Pathways in cancer mmu05210   Colorectal cancer mmu05211   Renal cell carcinoma mmu05212   Pancreatic cancer mmu05214   Glioma mmu05215   Prostate cancer mmu05223   Non-small cell lung cancer mmu05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     21802 (Tgfa)    04012 ErbB signaling pathway     21802 (Tgfa)    04014 Ras signaling pathway     21802 (Tgfa)    04020 Calcium signaling pathway     21802 (Tgfa)    04151 PI3K-Akt signaling pathway     21802 (Tgfa)  09150 Organismal Systems   09152 Endocrine system    04915 Estrogen signaling pathway     21802 (Tgfa)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     21802 (Tgfa)   09162 Cancer: specific types    05210 Colorectal cancer     21802 (Tgfa)    05212 Pancreatic cancer     21802 (Tgfa)    05225 Hepatocellular carcinoma     21802 (Tgfa)    05214 Glioma     21802 (Tgfa)    05211 Renal cell carcinoma     21802 (Tgfa)    05215 Prostate cancer     21802 (Tgfa)    05223 Non-small cell lung cancer     21802 (Tgfa)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     21802 (Tgfa)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmu04052]     21802 (Tgfa) Cytokines and neuropeptides [BR:mmu04052]  Cytokines   Growth factors (RTK binding)    21802 (Tgfa) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EGF EGF_Teneurin TMEM154 Motif Other DBs NCBI-GeneID:  21802 NCBI-ProteinID:  NP_112476 MGI:  98724 Ensembl:  ENSMUSG00000029999 UniProt:  P48030 Q545E4 LinkDB All DBs Position 6:86172020..86252726 Genome browser AA seq 159 aa AA seqDB search MVPATGQLALLALGILLAVCQALENSTSPLSDSPVAAAVVSHFNKCPDSHTQYCFHGTCR FLVQEEKPACVCHSGYVGVRCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI HCCQLRKHCEWCRALVCRHEKPSALLKGRTACCHSETVV NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atggtccccgcgaccggacagctcgctctgctagcgctgggtatcctgttagctgtgtgc caggctctggagaacagcacatcccccctgagtgactcacccgtggcggctgcagtggtg tctcacttcaacaagtgcccagattcccacactcagtactgcttccatggaacctgccgg tttttggtgcaggaagagaagccagcatgtgtctgccactctgggtacgtgggtgttcgc tgtgagcatgcagacctcctggctgtggtggctgccagccagaagaagcaagccatcact gccctggtggtggtctccattgtggccctggctgtcctcattatcacctgtgtgctgatc cactgctgtcagctccgcaaacactgtgagtggtgccgtgccctcgtctgcagacatgag aagcccagcgccctcctgaagggaaggactgcttgctgccactctgagacagtggtctga

DBGET integrated database retrieval system