KEGG   Mus musculus (mouse): 21802Help
Entry
21802             CDS       T01002                                 

Gene name
Tgfa, wa-1, wa1
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04915  Estrogen signaling pathway
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05223  Non-small cell lung cancer
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    21802 (Tgfa)
   04010 MAPK signaling pathway
    21802 (Tgfa)
   04012 ErbB signaling pathway
    21802 (Tgfa)
   04151 PI3K-Akt signaling pathway
    21802 (Tgfa)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    21802 (Tgfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    21802 (Tgfa)
  09162 Cancer: specific types
   05210 Colorectal cancer
    21802 (Tgfa)
   05212 Pancreatic cancer
    21802 (Tgfa)
   05225 Hepatocellular carcinoma
    21802 (Tgfa)
   05214 Glioma
    21802 (Tgfa)
   05211 Renal cell carcinoma
    21802 (Tgfa)
   05215 Prostate cancer
    21802 (Tgfa)
   05223 Non-small cell lung cancer
    21802 (Tgfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    21802 (Tgfa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF TMEM154
Motif
Other DBs
NCBI-GeneID: 21802
NCBI-ProteinID: NP_112476
MGI: 98724
Ensembl: ENSMUSG00000029999
Vega: OTTMUSG00000049992
UniProt: P48030 Q545E4
LinkDB All DBs
Position
6 D1; 6 37.62 cM
AA seq 159 aa AA seqDB search
MVPATGQLALLALGILLAVCQALENSTSPLSDSPVAAAVVSHFNKCPDSHTQYCFHGTCR
FLVQEEKPACVCHSGYVGVRCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI
HCCQLRKHCEWCRALVCRHEKPSALLKGRTACCHSETVV
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggtccccgcgaccggacagctcgctctgctagcgctgggtatcctgttagctgtgtgc
caggctctggagaacagcacatcccccctgagtgactcacccgtggcggctgcagtggtg
tctcacttcaacaagtgcccagattcccacactcagtactgcttccatggaacctgccgg
tttttggtgcaggaagagaagccagcatgtgtctgccactctgggtacgtgggtgttcgc
tgtgagcatgcagacctcctggctgtggtggctgccagccagaagaagcaagccatcact
gccctggtggtggtctccattgtggccctggctgtcctcattatcacctgtgtgctgatc
cactgctgtcagctccgcaaacactgtgagtggtgccgtgccctcgtctgcagacatgag
aagcccagcgccctcctgaagggaaggactgcttgctgccactctgagacagtggtctga

DBGET integrated database retrieval system